Size:100 ul
Special Price $229.00 Regular Price $289.00
In stock
SKU
ARP60777_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP60777_P050-FITC Conjugated

ARP60777_P050-HRP Conjugated

ARP60777_P050-Biotin Conjugated

More Information
Tested Species Reactivity Human, Mouse
Predicted Species Reactivity Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-120040 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human ENO2
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 93%; Zebrafish: 93%
Complete computational species homology data Anti-ENO2 (ARP60777_P050)
Peptide Sequence Synthetic peptide located within the following region: ESFRDAMRLGAEVYHTLKGVIKDKYGKDATNVGDEGGFAPNILENSEALE
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-ENO2 (ARP60777_P050) antibody is Catalog # AAP60777 (Previous Catalog # AAPP46966)
Datasheets/Manuals Printable datasheet for anti-ENO2 (ARP60777_P050) antibody
Publications

Choudhuri, A., Maitra, U. & Evans, T. Translation initiation factor eICC/IF3h targets specICC/IFic transcripts to polysomes during embryogenesis. Proc. Natl. Acad. Sci. U. S. A. 110, 9818-23 (2013). WB, Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish 23716667

Gene Symbol ENO2
Official Gene Full Name Enolase 2 (gamma, neuronal)
Alias Symbols NSE
NCBI Gene Id 2026
Protein Name Gamma-enolase
Description of Target This gene encodes one of the three enolase isoenzymes found in mammals. This isoenzyme, a homodimer, is found in mature neurons and cells of neuronal origin. A switch from alpha enolase to gamma enolase occurs in neural tissue during development in rats and primates.
Swissprot Id P09104
Protein Accession # NP_001966
Nucleotide Accession # NM_001975
Protein Size (# AA) 434
Molecular Weight 47kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express ENO2.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express ENO2.
Protein Interactions EXOC5; UBC; ASB9; ASB5; GMPS; RCN1; RAB1A; PNP; COASY; EFHD2; A2M; AKT1; UBD; CDK2; CAND1; CUL1; CUL2; CUL3; CUL4B; ACD; TINF2; POT1; TERF1; PPP1CC; PPP1CA; SUMO1; SUMO4; HABP4; NAT9; C6orf47; C16orf45; SIGIRR; ENSA; SNUPN; ST3GAL2; UBE2C; IL17B; ANXA11;
Write Your Own Review
You're reviewing:ENO2 Antibody - middle region (ARP60777_P050)
Your Rating