Search Antibody, Protein, and ELISA Kit Solutions

ENO2 Antibody - middle region (ARP60777_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP60777_P050-FITC Conjugated

ARP60777_P050-HRP Conjugated

ARP60777_P050-Biotin Conjugated

Tested Species Reactivity:
Human, Mouse
Predicted Species Reactivity:
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
Official Gene Full Name:
Enolase 2 (gamma, neuronal)
NCBI Gene Id:
Protein Name:
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-120040 from Santa Cruz Biotechnology.
Description of Target:
This gene encodes one of the three enolase isoenzymes found in mammals. This isoenzyme, a homodimer, is found in mature neurons and cells of neuronal origin. A switch from alpha enolase to gamma enolase occurs in neural tissue during development in rats and primates.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express ENO2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express ENO2.
The immunogen is a synthetic peptide directed towards the middle region of human ENO2
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 93%; Zebrafish: 93%
Complete computational species homology data:
Anti-ENO2 (ARP60777_P050)
Peptide Sequence:
Synthetic peptide located within the following region: ESFRDAMRLGAEVYHTLKGVIKDKYGKDATNVGDEGGFAPNILENSEALE
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-ENO2 (ARP60777_P050) antibody is Catalog # AAP60777 (Previous Catalog # AAPP46966)
Printable datasheet for anti-ENO2 (ARP60777_P050) antibody

Choudhuri, A., Maitra, U. & Evans, T. Translation initiation factor eICC/IF3h targets specICC/IFic transcripts to polysomes during embryogenesis. Proc. Natl. Acad. Sci. U. S. A. 110, 9818-23 (2013). WB, Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish 23716667

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...