Size:100 ul
$319.00
In stock
SKU
P100923_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

P100923_P050-FITC Conjugated

P100923_P050-HRP Conjugated

P100923_P050-Biotin Conjugated

EN1 Antibody - C-terminal region (P100923_P050)

Catalog#: P100923_P050
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Guinea Pig, Rabbit
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-128529 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human EN1
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Guinea Pig: 93%; Rabbit: 86%
Complete computational species homology data Anti-EN1 (P100923_P050)
Peptide Sequence Synthetic peptide located within the following region: LMGSANGGPVVKTDSQQPLVWPAWVYCTRYSDRPSSGPRTRKLKKKKNEK
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-EN1 (P100923_P050) antibody is Catalog # AAP31276 (Previous Catalog # AAPP02025)
Datasheets/Manuals Printable datasheet for anti-EN1 (P100923_P050) antibody
Target Reference Atit,R., (2006) Dev. Biol. 296 (1), 164-176
Publications

Beltran, A. S., Graves, L. M. & Blancafort, P. Novel role of Engrailed 1 as a prosurvival transcription factor in basal-like breast cancer and engineering of interference peptides block its oncogenic function. Oncogene. 33, 4767-77 (2014). WB, Guinea Pig, Rabbit 24141779

Gene Symbol EN1
Official Gene Full Name Engrailed homeobox 1
Alias Symbols -
NCBI Gene Id 2019
Protein Name Homeobox protein engrailed-1
Description of Target Homeobox-containing genes are thought to have a role in controlling development. In Drosophila, the 'engrailed' (en) gene plays an important role during development in segmentation, where it is required for the formation of posterior compartments. Different mutations in the mouse homologs, En1 and En2, produced different developmental defects that frequently are lethal. The human engrailed homologs 1 and 2 encode homeodomain-containing proteins and have been implicated in the control of pattern formation during development of the central nervous system.Homeobox-containing genes are thought to have a role in controlling development. In Drosophila, the 'engrailed' (en) gene plays an important role during development in segmentation, where it is required for the formation of posterior compartments. Different mutations in the mouse homologs, En1 and En2, produced different developmental defects that frequently are lethal. The human engrailed homologs 1 and 2 encode homeodomain-containing proteins and have been implicated in the control of pattern formation during development of the central nervous system. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Swissprot Id Q05925
Protein Accession # NP_001417
Nucleotide Accession # NM_001426
Protein Size (# AA) 392
Molecular Weight 40kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express EN1.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express EN1.
Protein Interactions TLE1; PAX6; JUN;
Write Your Own Review
You're reviewing:EN1 Antibody - C-terminal region (P100923_P050)
Your Rating