Size:100 ul
$319.00
In Stock
SKU
P100923_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

P100923_P050-FITC Conjugated

P100923_P050-HRP Conjugated

P100923_P050-Biotin Conjugated

EN1 Antibody - C-terminal region (P100923_P050)

Catalog#: P100923_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Guinea Pig, Rabbit
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-128529 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human EN1
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Guinea Pig: 93%; Rabbit: 86%
Complete computational species homology data Anti-EN1 (P100923_P050)
Peptide Sequence Synthetic peptide located within the following region: LMGSANGGPVVKTDSQQPLVWPAWVYCTRYSDRPSSGPRTRKLKKKKNEK
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-EN1 (P100923_P050) antibody is Catalog # AAP31276 (Previous Catalog # AAPP02025)
Datasheets/Manuals Printable datasheet for anti-EN1 (P100923_P050) antibody
Target Reference Atit,R., (2006) Dev. Biol. 296 (1), 164-176
Publications

Beltran, A. S., Graves, L. M. & Blancafort, P. Novel role of Engrailed 1 as a prosurvival transcription factor in basal-like breast cancer and engineering of interference peptides block its oncogenic function. Oncogene. 33, 4767-77 (2014). WB, Guinea Pig, Rabbit 24141779

Gene Symbol EN1
Official Gene Full Name Engrailed homeobox 1
Alias Symbols -
NCBI Gene Id 2019
Protein Name Homeobox protein engrailed-1
Description of Target Homeobox-containing genes are thought to have a role in controlling development. In Drosophila, the 'engrailed' (en) gene plays an important role during development in segmentation, where it is required for the formation of posterior compartments. Different mutations in the mouse homologs, En1 and En2, produced different developmental defects that frequently are lethal. The human engrailed homologs 1 and 2 encode homeodomain-containing proteins and have been implicated in the control of pattern formation during development of the central nervous system.Homeobox-containing genes are thought to have a role in controlling development. In Drosophila, the 'engrailed' (en) gene plays an important role during development in segmentation, where it is required for the formation of posterior compartments. Different mutations in the mouse homologs, En1 and En2, produced different developmental defects that frequently are lethal. The human engrailed homologs 1 and 2 encode homeodomain-containing proteins and have been implicated in the control of pattern formation during development of the central nervous system. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Swissprot Id Q05925
Protein Accession # NP_001417
Nucleotide Accession # NM_001426
Protein Size (# AA) 392
Molecular Weight 40kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express EN1.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express EN1.
Protein Interactions TLE1; PAX6; JUN;
  1. What is the species homology for "EN1 Antibody - C-terminal region (P100923_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Guinea Pig, Rabbit".

  2. How long will it take to receive "EN1 Antibody - C-terminal region (P100923_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "EN1 Antibody - C-terminal region (P100923_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "EN1 Antibody - C-terminal region (P100923_P050)"?

    This target may also be called "-" in publications.

  5. What is the shipping cost for "EN1 Antibody - C-terminal region (P100923_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "EN1 Antibody - C-terminal region (P100923_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "EN1 Antibody - C-terminal region (P100923_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "40kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "EN1 Antibody - C-terminal region (P100923_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "EN1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "EN1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "EN1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "EN1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "EN1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "EN1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:EN1 Antibody - C-terminal region (P100923_P050)
Your Rating
We found other products you might like!