Search Antibody, Protein, and ELISA Kit Solutions

EN1 antibody - C-terminal region (P100923_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

P100923_P050-FITC Conjugated

P100923_P050-HRP Conjugated

P100923_P050-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
Engrailed homeobox 1
Protein Name:
Homeobox protein engrailed-1
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-128529 from Santa Cruz Biotechnology.
Description of Target:
Homeobox-containing genes are thought to have a role in controlling development. In Drosophila, the 'engrailed' (en) gene plays an important role during development in segmentation, where it is required for the formation of posterior compartments. Different mutations in the mouse homologs, En1 and En2, produced different developmental defects that frequently are lethal. The human engrailed homologs 1 and 2 encode homeodomain-containing proteins and have been implicated in the control of pattern formation during development of the central nervous system.Homeobox-containing genes are thought to have a role in controlling development. In Drosophila, the 'engrailed' (en) gene plays an important role during development in segmentation, where it is required for the formation of posterior compartments. Different mutations in the mouse homologs, En1 and En2, produced different developmental defects that frequently are lethal. The human engrailed homologs 1 and 2 encode homeodomain-containing proteins and have been implicated in the control of pattern formation during development of the central nervous system. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express EN1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express EN1.
The immunogen is a synthetic peptide directed towards the C terminal region of human EN1
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Guinea Pig: 93%; Rabbit: 86%
Complete computational species homology data:
Anti-EN1 (P100923_P050)
Peptide Sequence:
Synthetic peptide located within the following region: LMGSANGGPVVKTDSQQPLVWPAWVYCTRYSDRPSSGPRTRKLKKKKNEK
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-EN1 (P100923_P050) antibody is Catalog # AAP31276 (Previous Catalog # AAPP02025)
Printable datasheet for anti-EN1 (P100923_P050) antibody
Target Reference:
Atit,R., (2006) Dev. Biol. 296 (1), 164-176

Beltran, A. S., Graves, L. M. & Blancafort, P. Novel role of Engrailed 1 as a prosurvival transcription factor in basal-like breast cancer and engineering of interference peptides block its oncogenic function. Oncogene (2013). doi:10.1038/onc.2013.422 WB, Guinea Pig, Rabbit 24141779

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...