Now Offering Over 102,157 Antibodies & 44,722 Antigens!

ZYX antibody - middle region (ARP34387_T100)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul

Regular Price: $229.00

Special Price: $215.00

In Stock

Conjugation Options

ARP34387_T100-FITC Conjugated

ARP34387_T100-HRP Conjugated

ARP34387_T100-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
ZYX
NCBI Gene Id:
7791
Official Gene Full Name:
Zyxin
Protein Name:
Zyxin
Swissprot Id:
Q15942
Protein Accession #:
NP_003452
Nucleotide Accession #:
NM_003461
Alias Symbols:
ESP-2, HED-2
Description of Target:
Focal adhesions are actin-rich structures that enable cells to adhere to the extracellular matrix and at which protein complexes involved in signal transduction assemble. Zyxin is a zinc-binding phosphoprotein that concentrates at focal adhesions and along the actin cytoskeleton. Zyxin may function as a messenger in the signal transduction pathway that mediates adhesion-stimulated changes in gene expression and may modulate the cytoskeletal organization of actin bundles.
Protein Size (# AA):
572
Molecular Weight:
61kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Protein A purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express ZYX.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express ZYX.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human ZYX
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Predicted Homology Based on Immunogen Sequence:
Cow: 85%; Dog: 92%; Guinea Pig: 92%; Horse: 100%; Human: 100%; Mouse: 85%; Rabbit: 92%; Rat: 91%
Complete computational species homology data:
Anti-ZYX (ARP34387_T100)
Peptide Sequence:
Synthetic peptide located within the following region: GSPQPPSFTYAQQREKPRVQEKQHPVPPPAQNQNQVRSPGAPGPLTLKEV
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
RTN4IP1; YPEL3; IMP3; PHF21A; PDLIM5; LIN7A; SUMO1; NEDD8; FAM129B; CORO1B; CAND1; PUF60; PAPOLA; NUDC; SEC23B; SEC24C; HIST1H4A; UGP2; TARS; PXN; GART; GARS; APEH; FN1; HIPK3; VCAM1; UBC; UBL7; UFC1; UBXN7; ZC3H7B; TTLL12; FERMT2; TOMM34; AHCYL1; SSSCA1;
Blocking Peptide:
For anti-ZYX (ARP34387_T100) antibody is Catalog # AAP34387 (Previous Catalog # AAPY00229)
Datasheets/Manuals:
Printable datasheet for anti-ZYX (ARP34387_T100) antibody
Sample Type Confirmation:

ZYX is strongly supported by BioGPS gene expression data to be expressed in HeLa

Target Reference:
Li,B., et al., (2004) J. Biol. Chem. 279 (19), 20401-20410
Publications:

Moody, J. D. et al. A zyxin head-tail interaction regulates zyxin-VASP complex formation. Biochem. Biophys. Res. Commun. 378, 625-8 (2009). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 19061869

Tell us what you think about this item!

Write A Review
    Please, wait...