Now Offering Over 102,157 Antibodies & 44,722 Antigens!

ZNF133 antibody - N-terminal region (ARP35674_P050)

100 ul

Regular Price: $289.00

Special Price: $215.00

In Stock

Conjugation Options

ARP35674_P050-FITC Conjugated

ARP35674_P050-HRP Conjugated

ARP35674_P050-Biotin Conjugated

Gene Symbol:
ZNF133
NCBI Gene Id:
7692
Official Gene Full Name:
Zinc finger protein 133
Protein Name:
Zinc finger protein 133
Swissprot Id:
Q53XU1
Protein Accession #:
NP_003425
Nucleotide Accession #:
NM_003434
Alias Symbols:
ZNF150, pHZ-13, pHZ-66
Replacement Item:
This antibody may replace item sc-130414 from Santa Cruz Biotechnology.
Description of Target:
ZNF133 may be involved in transcriptional regulation as a repressor.
Protein Size (# AA):
653
Molecular Weight:
73kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
IF, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express ZNF133.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express ZNF133.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF133
Species Reactivity:
Horse, Human, Mouse, Pig, Rabbit
Predicted Homology Based on Immunogen Sequence:
Horse: 92%; Human: 100%; Mouse: 83%; Pig: 100%; Rabbit: 93%
Complete computational species homology data:
Anti-ZNF133 (ARP35674_P050)
Peptide Sequence:
Synthetic peptide located within the following region: LRGVELEASPAQTGNPEETDKLLKRIEVLGFGTVNCGECGLSFSKMTNLL
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
KRTAP10-7; MDM2; FOS; TRIM28; MAPK6; PDPK1; ILK;
Blocking Peptide:
For anti-ZNF133 (ARP35674_P050) antibody is Catalog # AAP35674 (Previous Catalog # AAPP06920)
Datasheets/Manuals:
Printable datasheet for anti-ZNF133 (ARP35674_P050) antibody
Sample Type Confirmation:

ZNF133 is strongly supported by BioGPS gene expression data to be expressed in 721_B

Target Reference:
Lee,S.J., (2007) Exp. Mol. Med. 39 (4), 450-457

Tell us what you think about this item!

Write A Review
    Please, wait...