Now Offering Over 102,157 Antibodies & 44,722 Antigens!

ZNF133 antibody - middle region (ARP38332_P050)

100 ul

Regular Price: $289.00

Special Price: $215.00

In Stock

Conjugation Options

ARP38332_P050-FITC Conjugated

ARP38332_P050-HRP Conjugated

ARP38332_P050-Biotin Conjugated

Gene Symbol:
ZNF133
NCBI Gene Id:
7692
Official Gene Full Name:
Zinc finger protein 133
Protein Name:
Zinc finger protein 133
Swissprot Id:
Q53XU1
Protein Accession #:
NP_003425
Nucleotide Accession #:
NM_003434
Alias Symbols:
ZNF150, pHZ-13, pHZ-66
Replacement Item:
This antibody may replace item sc-130414 from Santa Cruz Biotechnology.
Description of Target:
ZNF193 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 5 C2H2-type zinc fingers and 1 SCAN box domain. ZNF193 may be involved in transcriptional regulation.
Protein Size (# AA):
653
Molecular Weight:
73kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
IF, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express ZNF133.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express ZNF133.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human ZNF133
Species Reactivity:
Human, Pig, Rabbit
Predicted Homology Based on Immunogen Sequence:
Human: 100%; Pig: 77%; Rabbit: 77%
Complete computational species homology data:
Anti-ZNF133 (ARP38332_P050)
Peptide Sequence:
Synthetic peptide located within the following region: KPYVCKTCGRGFSLKSHLSRHRKTTSVHHRLPVQPDPEPCAGQPSDSLYS
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
KRTAP10-7; MDM2; FOS; TRIM28; MAPK6; PDPK1; ILK;
Blocking Peptide:
For anti-ZNF133 (ARP38332_P050) antibody is Catalog # AAP38332 (Previous Catalog # AAPP20519)
Datasheets/Manuals:
Printable datasheet for anti-ZNF133 (ARP38332_P050) antibody
Target Reference:
Lee,S.J., (2007) Exp. Mol. Med. 39 (4), 450-457

Tell us what you think about this item!

Write A Review
    Please, wait...