Now Offering Over 102,157 Antibodies & 44,722 Antigens!

ZFP95 antibody - N-terminal region : FITC (ARP31830_T100-FITC)

Print Page
  • Let us Help: Ask a Question
100 ul
In Stock

Conjugation Options

ARP31830_T100 Unconjugated

ARP31830_T100-HRP Conjugated

ARP31830_T100-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
Zinc finger with KRAB and SCAN domains 5
Protein Name:
Zinc finger protein with KRAB and SCAN domains 5
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
ZFP95, ZNF914
Replacement Item:
This antibody may replace item sc-89452 from Santa Cruz Biotechnology.
Description of Target:
ZFP95 is a zinc finger protein of the Kruppel family. It contains a SCAN box and a KRAB A domain. A similar protein in mouse is differentially expressed in spermatogenesis.
Protein Size (# AA):
Molecular Weight:
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express ZFP95.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express ZFP95.
The immunogen is a synthetic peptide directed towards the N terminal region of human ZFP95
Species Reactivity:
Dog, Guinea Pig, Horse, Human, Mouse, Pig
Predicted Homology Based on Immunogen Sequence:
Dog: 92%; Guinea Pig: 86%; Horse: 92%; Human: 100%; Mouse: 79%; Pig: 100%
Complete computational species homology data:
Anti-ZFP95 (ARP31830_T100)
Peptide Sequence:
Synthetic peptide located within the following region: MIMTESREVIDLDPPAETSQEQEDLFIVKVEEEDCTWMQEYNPPTFETFY
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-ZKSCAN5 (ARP31830_T100-FITC) antibody is Catalog # AAP31830 (Previous Catalog # AAPP02625)
Printable datasheet for anti-ZKSCAN5 (ARP31830_T100-FITC) antibody
FITC (FAM): Excitation 495 nm/ Emission 520 nm
Target Reference:
Scherer,S.W., et al., (2003) Science 300 (5620), 767-772
Ask a Question

Tell us what you think about this item!

Write A Review
    Please, wait...