Now Offering Over 102,157 Antibodies & 44,722 Antigens!

ZEB1 antibody - N-terminal region (ARP32422_P050)

100 ul

Regular Price: $289.00

Special Price: $215.00

In Stock

Conjugation Options

ARP32422_P050-FITC Conjugated

ARP32422_P050-HRP Conjugated

ARP32422_P050-Biotin Conjugated

Gene Symbol:
ZEB1
NCBI Gene Id:
6935
Official Gene Full Name:
Zinc finger E-box binding homeobox 1
Protein Name:
Zinc finger E-box-binding homeobox 1
Swissprot Id:
P37275
Protein Accession #:
NP_110378
Nucleotide Accession #:
NM_030751
Alias Symbols:
AREB6, BZP, MGC133261, NIL-2-A, NIL-2A, TCF8, ZEB, ZFHEP, ZFHX1A, FECD6, NIL2A, PPCD3, DELTAEF1
Replacement Item:
This antibody may replace item sc-10570 from Santa Cruz Biotechnology.
Description of Target:
ZEB1 is a zinc finger transcription factor that represses T-lymphocyte-specific IL2 gene expression by binding to a negative regulatory domain 100 nucleotides 5-prime of the IL2 transcription start site.ZEB1 encodes a zinc finger transcription factor that represses T-lymphocyte-specific IL2 gene (MIM 147680) expression by binding to a negative regulatory domain 100 nucleotides 5-prime of the IL2 transcription start site (Williams et al., 1991 [PubMed 1840704]).[supplied by OMIM].
Protein Size (# AA):
1124
Molecular Weight:
124kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
IF, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express ZEB1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express ZEB1.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human ZEB1
Species Reactivity:
Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data:
Anti-ZEB1 (ARP32422_P050)
Peptide Sequence:
Synthetic peptide located within the following region: KDDECESDAENEQNHDPNVEEFLQQQDTAVIFPEAPEEDQRQGTPEASGH
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
SUMO1; CDK6; GTF2A1; UBR4; SUMO2; SIRT1; SOX2; CTBP2; CTBP1; SMAD7; SMAD6; SMARCA4; SERPINH1; SMAD3; EP300; DRAP1; KAT5; SMAD2; SMAD1; CDH1;
Blocking Peptide:
For anti-ZEB1 (ARP32422_P050) antibody is Catalog # AAP32422 (Previous Catalog # AAPP03417)
Datasheets/Manuals:
Printable datasheet for anti-ZEB1 (ARP32422_P050) antibody
Sample Type Confirmation:

ZEB1 is strongly supported by BioGPS gene expression data to be expressed in Jurkat

Target Reference:
Gregory,P.A., (2008) Nat. Cell Biol. 10 (5), 593-601
Publications:

Lobert, S., Graichen, M. E. & Morris, K. Coordinated regulation of β-tubulin isotypes and epithelial-to-mesenchymal transition protein ZEB1 in breast cancer cells. Biochemistry 52, 5482-90 (2013). IF, WB, Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat 23869586

Tell us what you think about this item!

Write A Review
    Please, wait...