Now Offering Over 102,157 Antibodies & 44,722 Antigens!

YSCF Recombinant Protein (Burkholderia thailandensis) (OPCA05164)

* Required Fields

$0.00
In Stock
Gene Symbol:
YSCF
Swissprot Id:
Q2T727
Protein Name:
Type III secretion apparatus needle protein
Molecular Weight:
12 kDa
Product Format:
Liquid
Species Reactivity:
Burkholderia thailandensis
Formulation:
Tris-base, 50% glycerol
Purity:
Greater than 90% as determined by SDS-PAGE.
Protein Sequence:
Full Length: MSNPPTPLLTDYEWSGYLTGIGRAFDTGVKDLNQQLQDAQANLTKNPSDPTALANYQMIMSEYNLYRNAQSSAVKSMKDIDSSIVSNFR
Storage Buffer:
Tris-base, 50% glycerol
Source:
Yeast
Additional Information:
Species Specificity Detail: Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CIP 106301 / E264)
Tag:
N-terminal 6xHis-tagged
Reconstitution and Storage:
Store at -20/-80C for 12 months. Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Target Reference:
Bacterial genome adaptation to niches: divergence of the potential virulence genes in three Burkholderia species of different survival strategies.
Kim H.S., Schell M.A., Yu Y., Ulrich R.L., Sarria S.H., Nierman W.C., DeShazer D.
BMC Genomics 6:174-174(2005)
Datasheets/Manuals:
Printable datasheet for OPCA05164
Protocol:
Tips Information:

Tell us what you think about this item!

Write A Review
    Please, wait...