Aviva Systems Biology office will be closed for Independence Day - July 4th, 2018.
Please go here for more info.

Now Offering Over 102,157 Antibodies & 44,722 Antigens!

YSCF Recombinant Protein (Burkholderia thailandensis) (OPCA05164)

Print Page
10ug
    $285.00
    In Stock
    Gene Symbol:
    YSCF
    Swissprot Id:
    Q2T727
    Protein Name:
    Type III secretion apparatus needle protein
    Molecular Weight:
    12 kDa
    Product Format:
    Liquid
    Species Reactivity:
    Burkholderia thailandensis
    Formulation:
    Tris-base, 50% glycerol
    Purity:
    Greater than 90% as determined by SDS-PAGE.
    Protein Sequence:
    Full Length: MSNPPTPLLTDYEWSGYLTGIGRAFDTGVKDLNQQLQDAQANLTKNPSDPTALANYQMIMSEYNLYRNAQSSAVKSMKDIDSSIVSNFR
    Storage Buffer:
    Tris-base, 50% glycerol
    Source:
    Yeast
    Additional Information:
    Species Specificity Detail: Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CIP 106301 / E264)
    Tag:
    N-terminal 6xHis-tagged
    Reconstitution and Storage:
    Store at -20/-80C for 12 months. Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
    Target Reference:
    Bacterial genome adaptation to niches: divergence of the potential virulence genes in three Burkholderia species of different survival strategies.
    Kim H.S., Schell M.A., Yu Y., Ulrich R.L., Sarria S.H., Nierman W.C., DeShazer D.
    BMC Genomics 6:174-174(2005)
    Datasheets/Manuals:
    Printable datasheet for OPCA05164
    Protocol:
    Tips Information:
     
    X
    Ask a Question

    Tell us what you think about this item!

    Write A Review
      Please, wait...