Now Offering Over 102,157 Antibodies & 44,722 Antigens!

VIM antibody - N-terminal region (ARP48225_P050)

100 ul

Regular Price: $289.00

Special Price: $215.00

In Stock

Conjugation Options

ARP48225_P050-FITC Conjugated

ARP48225_P050-HRP Conjugated

ARP48225_P050-Biotin Conjugated

Gene Symbol:
VIM
NCBI Gene Id:
7431
Official Gene Full Name:
Vimentin
Protein Name:
Vimentin
Swissprot Id:
P08670
Protein Accession #:
NP_003371
Nucleotide Accession #:
NM_003380
Alias Symbols:
FLJ36605
Replacement Item:
This antibody may replace item sc-32322 from Santa Cruz Biotechnology.
Description of Target:
Along with the microfilaments (actins) and microtubules (tubulins), the intermediate filaments represent a third class of well-characterized cytoskeletal elements. The subunits display a tissue-specific pattern of expression. Desmin is the subunit specific for muscle and vimentin the subunit specific for mesenchymal tissue.Along with the microfilaments (actins) and microtubules (tubulins), the intermediate filaments represent a third class of well-characterized cytoskeletal elements. The subunits display a tissue-specific pattern of expression. Desmin (MIM 125660) is the subunit specific for muscle and vimentin the subunit specific for mesenchymal tissue.[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Protein Size (# AA):
466
Molecular Weight:
54kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express VIM.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express VIM.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human VIM
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%
Complete computational species homology data:
Anti-VIM (ARP48225_P050)
Peptide Sequence:
Synthetic peptide located within the following region: LNDRFANYIDKVRFLEQQNKILLAELEQLKGQGKSRLGDLYEEEMRELRR
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
PKN1; PPL; PLA2G2A; PA2G4; KRT20; TXLNB; CWF19L2; PNMA5; UBC; TP53; CHFR; SPRTN; SUMO2; SUMO3; TRIM68; STAU1; ASB15; ASB9; ASB16; ASB2; RNF2; EEF1D; SERPINH1; COPS8; FOXK1; YWHAQ; PARK2; FBXO6; CASP7; CASP3; KAT7; UBD; PINK1; BAG3; GSK3B; PAN2; CAPN1; SVI
Blocking Peptide:
For anti-VIM (ARP48225_P050) antibody is Catalog # AAP48225 (Previous Catalog # AAPS22911)
Datasheets/Manuals:
Printable datasheet for anti-VIM (ARP48225_P050) antibody
Target Reference:
Dawson,S.J. (2008) Biochemistry 47 (18), 5127-5138

Tell us what you think about this item!

Write A Review
    Please, wait...