Now Offering Over 102,157 Antibodies & 44,722 Antigens!

USP9X antibody - C-terminal region (ARP59340_P050)

Print Page
100 ul

Regular Price: $289.00

Special Price: $215.00

In Stock

Conjugation Options

ARP59340_P050-FITC Conjugated

ARP59340_P050-HRP Conjugated

ARP59340_P050-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
Ubiquitin specific peptidase 9, X-linked
Protein Name:
Probable ubiquitin carboxyl-terminal hydrolase FAF-X
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-100628 from Santa Cruz Biotechnology.
Description of Target:
This gene is a member of the peptidase C19 family and encodes a protein that is similar to ubiquitin-specific proteases. Though this gene is located on the X chromosome, it escapes X-inactivation. Mutations in this gene have been associated with Turner syndrome. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express USP9X.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express USP9X.
The immunogen is a synthetic peptide directed towards the C terminal region of human USP9X
Species Reactivity:
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Horse: 93%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data:
Anti-USP9X (ARP59340_P050)
Peptide Sequence:
Synthetic peptide located within the following region: SQYQQNNHVHGQPYTGPAAHHMNNPQRTGQRAQENYEGSEEVSPPQTKDQ
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-USP9X (ARP59340_P050) antibody is Catalog # AAP59340 (Previous Catalog # AAPP45438)
Printable datasheet for anti-USP9X (ARP59340_P050) antibody
Sample Type Confirmation:

USP9X is strongly supported by BioGPS gene expression data to be expressed in HEK293T

Ask a Question

Tell us what you think about this item!

Write A Review
    Please, wait...