Now Offering Over 102,157 Antibodies & 44,722 Antigens!

USP30 antibody - middle region (ARP50098_P050)

Print Page
100 ul

Regular Price: $289.00

Special Price: $215.00

In Stock

Conjugation Options

ARP50098_P050-FITC Conjugated

ARP50098_P050-HRP Conjugated

ARP50098_P050-Biotin Conjugated

Gene Symbol:
USP30
NCBI Gene Id:
84749
Official Gene Full Name:
Ubiquitin specific peptidase 30
Protein Name:
Ubiquitin carboxyl-terminal hydrolase 30
Swissprot Id:
Q70CQ3
Protein Accession #:
NP_116052
Nucleotide Accession #:
NM_032663
Alias Symbols:
FLJ40511, MGC10702
Replacement Item:
This antibody may replace item sc-109455 from Santa Cruz Biotechnology.
Description of Target:
USP30, a member of the ubiquitin-specific protease family (see USP1, MIM 603478), is a novel mitochondrial deubiquitinating (DUB) enzyme (Nakamura and Hirose, 2008 [PubMed 18287522]).
Protein Size (# AA):
508
Molecular Weight:
57kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express USP30.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express USP30.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human USP30
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data:
Anti-USP30 (ARP50098_P050)
Peptide Sequence:
Synthetic peptide located within the following region: SCLLDVLRMYRWQISSFEEQDAHELFHVITSSLEDERDRQPRVTHLFDVH
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
UBC; MPND; CLPB; SS18L1; SF3A1; QKI; TIMM8A;
Blocking Peptide:
For anti-USP30 (ARP50098_P050) antibody is Catalog # AAP50098 (Previous Catalog # AAPP44760)
Datasheets/Manuals:
Printable datasheet for anti-USP30 (ARP50098_P050) antibody
 
X
Ask a Question

Tell us what you think about this item!

Write A Review
    Please, wait...