Now Offering Over 102,157 Antibodies & 44,722 Antigens!

USP15 antibody - C-terminal region (ARP59309_P050)

100 ul

Regular Price: $289.00

Special Price: $215.00

In Stock

Conjugation Options

ARP59309_P050-FITC Conjugated

ARP59309_P050-HRP Conjugated

ARP59309_P050-Biotin Conjugated

Gene Symbol:
USP15
NCBI Gene Id:
9958
Official Gene Full Name:
Ubiquitin specific peptidase 15
Protein Name:
Ubiquitin carboxyl-terminal hydrolase 15
Swissprot Id:
Q9Y4E8
Protein Accession #:
NP_006304
Nucleotide Accession #:
NM_006313
Alias Symbols:
KIAA0529, MGC131982, MGC149838, MGC74854, UNPH4, UNPH-2
Replacement Item:
This antibody may replace item sc-100629 from Santa Cruz Biotechnology.
Description of Target:
Ubiquitin (MIM 191339), a highly conserved protein involved in the regulation of intracellular protein breakdown, cell cycle regulation, and stress response, is released from degraded proteins by disassembly of the polyubiquitin chains. The disassembly process is mediated by ubiquitin-specific proteases (USPs). Also see USP1 (MIM 603478).
Protein Size (# AA):
952
Molecular Weight:
109kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
IF, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express USP15.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express USP15.
Immunogen:
The immunogen is a synthetic peptide directed towards the C terminal region of human USP15
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data:
Anti-USP15 (ARP59309_P050)
Peptide Sequence:
Synthetic peptide located within the following region: GNTDINYIKDDTRHIRFDDRQLRLDERSFLALDWDPDLKKRYFDENAAED
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
CARD9; SPDL1; CCDC57; MAD1L1; TRIM21; HUWE1; SART3; UBC; TGFBR1; SMAD6; BMPR1B; BMPR1A; ACVR1; SHFM1; TRIM25; TRAF4; RNF40; HIST2H2BE; HIST2H2AC; RNF20; NUSAP1; UGP2; PLOD2; SOX2; NPM1; LMNA; BIRC3; BIRC2; FN1; TRIM74; RNF144B; TRIM5; TRIM46; SMURF1; RNF1
Blocking Peptide:
For anti-USP15 (ARP59309_P050) antibody is Catalog # AAP59309 (Previous Catalog # AAPP45294)
Datasheets/Manuals:
Printable datasheet for anti-USP15 (ARP59309_P050) antibody

Tell us what you think about this item!

Write A Review
    Please, wait...