Now Offering Over 102,157 Antibodies & 44,722 Antigens!

UNC5A antibody - middle region (ARP50294_P050)

100 ul
$289.00
In Stock

Conjugation Options

ARP50294_P050-FITC Conjugated

ARP50294_P050-HRP Conjugated

ARP50294_P050-Biotin Conjugated

Gene Symbol:
UNC5A
NCBI Gene Id:
90249
Official Gene Full Name:
Unc-5 homolog A (C. elegans)
Protein Name:
Netrin receptor UNC5A
Swissprot Id:
Q6ZN44
Protein Accession #:
NP_588610
Nucleotide Accession #:
NM_133369
Alias Symbols:
FLJ16449, KIAA1976, UNC5H1
Replacement Item:
This antibody may replace item sc-67905 from Santa Cruz Biotechnology.
Description of Target:
UNC5A belongs to a family of netrin-1 receptors thought to mediate the chemorepulsive effect of netrin-1 on specific axons. For more information on UNC5 proteins, see UNC5C.UNC5A belongs to a family of netrin-1 (MIM 601614) receptors thought to mediate the chemorepulsive effect of netrin-1 on specific axons. For more information on UNC5 proteins, see UNC5C (MIM 603610).[supplied by OMIM].
Protein Size (# AA):
842
Molecular Weight:
93kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express UNC5A.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express UNC5A.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human UNC5A
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Complete computational species homology data:
Anti-UNC5A (ARP50294_P050)
Peptide Sequence:
Synthetic peptide located within the following region: VYCRKKEGLDSDVADSSILTSGFQPVSIKPSKADNPHLLTIQPDLSTTTT
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
DAP; MAGED1; NTN1; DAPK1;
Blocking Peptide:
For anti-UNC5A (ARP50294_P050) antibody is Catalog # AAP50294 (Previous Catalog # AAPY03371)
Datasheets/Manuals:
Printable datasheet for anti-UNC5A (ARP50294_P050) antibody
Target Reference:
Souchet,M., (2004) Nat. Rev. Cancer 4 (12), 978-987

Tell us what you think about this item!

Write A Review
    Please, wait...