Now Offering Over 102,157 Antibodies & 44,722 Antigens!

UCHL1 antibody - C-terminal region (ARP58968_P050)

100 ul

Regular Price: $289.00

Special Price: $215.00

In Stock

Conjugation Options

ARP58968_P050-FITC Conjugated

ARP58968_P050-HRP Conjugated

ARP58968_P050-Biotin Conjugated

Gene Symbol:
UCHL1
NCBI Gene Id:
7345
Official Gene Full Name:
Ubiquitin carboxyl-terminal esterase L1 (ubiquitin thiolesterase)
Protein Name:
Ubiquitin carboxyl-terminal hydrolase isozyme L1
Swissprot Id:
P09936
Protein Accession #:
NP_004172
Nucleotide Accession #:
NM_004181
Alias Symbols:
PARK5, PGP9.5, PGP95, Uch-L1, PGP 9.5
Replacement Item:
This antibody may replace item sc-176636 from Santa Cruz Biotechnology.
Description of Target:
The protein encoded by this gene belongs to the peptidase C12 family. This enzyme is a thiol protease that hydrolyzes a peptide bond at the C-terminal glycine of ubiquitin. This gene is specifically expressed in the neurons and in cells of the diffuse neuroendocrine system. Mutations in this gene may be associated with Parkinson disease.
Protein Size (# AA):
223
Molecular Weight:
25kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express UCHL1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express UCHL1.
Immunogen:
The immunogen is a synthetic peptide directed towards the C terminal region of human UCHL1
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%
Complete computational species homology data:
Anti-UCHL1 (ARP58968_P050)
Peptide Sequence:
Synthetic peptide located within the following region: HLYELDGRMPFPVNHGASSEDTLLKDAAKVCREFTEREQGEVRFSAVALC
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
UBC; ERN1; TNFRSF1A; NMRAL1; TRAF6; TRAF3; PMAIP1; CDK6; CDK5; CDK4; CDK1; IQCB1; RPTOR; DDB1; WDR82; TRIM63; USP28; TRIM54; USP21; USP15; NCAM1; AKT1; CDK2; ADRB2; ADRA2C; ADRA2B; ADRA2A; TERF2IP; TINF2; TUBA1A; LAMP2; HSP90AA1; HSPA8; PLA2G2A; CDKN2A; T
Blocking Peptide:
For anti-UCHL1 (ARP58968_P050) antibody is Catalog # AAP58968 (Previous Catalog # AAPP45304)
Datasheets/Manuals:
Printable datasheet for anti-UCHL1 (ARP58968_P050) antibody
Sample Type Confirmation:

UCHL1 is supported by BioGPS gene expression data to be expressed in 721_B

Average Rating:
4 reviews
5 star
1
4 star
3
3 star
0
2 star
0
1 star
0
  • Date - Newest First
  • Date - Newest First
  • Date - Latest First
  • Highest Rated
  • Lowest Rated
  • Most Helpful
  • Ownership

4 Item(s)

02/01/2017 16:24
  • Overall Experience:
  • Quality:
Product Review: UCHL1 antibody-C-terminal region (ARP58968_P050) in Human pancreas using IHC
Product Page for UCHL1 antibody-C-terminal region (ARP58968_P050)

Researcher: G. Martens and B. Brackeva, Diabetes Research Center, Brussels Free University (VUB)
Application: IHC
Species + Tissue/Cell type: Human pancreas
Primary antibody dilution: 1:1000
Secondary antibody: Anti-rabbit-Dylight 548
Secondary antibody dilution: 1:300


Questionnaire:
How do Aviva's reagents play a role in your experimental goals? Antibodies are neede for detection of target protein on immunostaining of human and rat pancreata
How would you rate this antibody on a scale from 1-5 (5=best) and why? 4 Strong staining, low background, HIER needed
Would you use this antibody in future experiments? Yes
Have you used another antibody which has worked in your application? Yes
Do you believe the information about the reagent on Aviva's website is correct? Yes
If the antibody works, do you plan to use it in future experiments or to publish your data? Why or why not? Yes, because of strong staining
How did you store the antibody after re-suspension?  -20 d C
Sample Description (please include 1) species type, and 2) cell/tissue type, and 3) how much protein loaded for each lane of your gel): Tisuue samples of human pancreas and rat pancreas
Please explain fixation solution/method used (formalin, perodate-lysine-paraformaldehyde, acetone, etc.)? Fixation with 10% formalin and Embedding in paraffine
How many different experimental trials were conducted using the antibody sample? 2
Primary antibody dilution, incubation time and temperature: Dilution 1/1000; incubation overnight at 4 d C in wet chamber
Secondary antibody used, dilution, incubation time and temperature: Donkey anti-rabbit IgG Dylight 548 by Jackjon Immunoresearch; dilution 1/300; incubation for 1h at room temperature in wet chamber
From your IHC/ICC images, briefly explain the colors of each stain and counterstain: UCHL-1 in green, Dapi in white, positive controls for pancreata: INS in red, glucagon in blue
Did you use an antigen retrieval method? If so, please explain? HEIR + Citrate or HEIR + EDTA
What controls were used in your experiment? Positive control:INS/GLU-Negative control:no primary Ab-only anti-Rabbit
Please include your detailed tissue preparation and staining procedure/protocol here:
Deparaffinizing - rehydration
* Decreasing alcohol baths
* Toluol x x x Alc 70% H2O
5' 5' 10'' 10'' 10'' 1'
Heat induced epitope retrieval (HIER)
* Steam cooker 2100 Retriever
* R-Buffer A 10x (citrate buffer) PickCell Laboratories cat#30110
100mL = 10mL + 90mL PBS
* 20' + 20' cooldown in the steamcooker
Blocking
* 10% Donkey serum
4000 uL = 400 uL + 3600 uL PBS
* Add 150uL dropwise to the slides
WASH
* Tap the slides gently on papertissue
* Put them in a glass holder filled with PBS for 2'
* Tap the slides gently and carefully dry the slide with papertissue -without touching the tissue-
Detection with Primary Abs
rabbit anti-UCHL1 Aviva Biosystems ARP59268
stock conc 1000.00 ug/mL
dilution 1000
final conc 1.00 ug/mL
rabbit anti-UCHL1 Aviva Biosystems ARP59285
stock conc 1000.00 ug/mL
dilution 1000
final conc 1.00 ug/mL
guinea-pig anti-INS in house
dilution 1000
predilution 100
rest dilution 10
mouse anti-GLU
predilution 40
rest dilution 100
UCH-L1 INS GLU
ARP59268 1000 uL = 1.0 uL 100.0 uL 10.0 uL 889 uL PBS
ARP59285 1000 uL = 1.0 uL 100.0 uL 10.0 uL 889 uL PBS
* <200uL per slide
* ON@4°C in wet chamber
WASH
* Tap the slides gently on papertissue
* Put them in a glass holder filled with PBS for 2'
* Tap the slides gently and carefully dry the slide with papertissue -without touching the tissue-
Detection with secondary Abs
donkey anti-Rabbit IgG Dylight 549 >UCH-L1 Jackson Immunoresearch
dilution 300
donkey anti-mouse IgG Dylight 488 >GLU Jackson Immunoresearch
dilution 300
donkey anti-GP IgG Dylight 649 >INS Jackson Immunoresearch cat#706-496-148 lot#96682
dilution 300
Atlas 300 uL = 1.0 uL 1.0 uL 1.0 uL 297 uL PBS
* 200uL per slide
* 60'@RT in wet chamber
WASH
* Tap the slides gently on papertissue
* Put them in a glass holder filled with PBS for 2'
* Tap the slides gently and carefully dry the slide with papertissue -without touching the tissue-
Stabilizing with mounting medium + DAPI
Dako Fluorescent Mounting Medium +DAPI (inhouse added) Dako cat#2010-10 lot#10036464
* One drop per slide
* Finish with cover slip
* Slides are analysed with Zeis Axioplan 2 Imaging
0
0
Reply
Show more comments (-2) Hide comments
02/01/2017 16:24
  • Overall Experience:
  • Quality:
Product Review: UCHL1 antibody-C-terminal region (ARP58968_P050) in Rat pancreas using IHC
Product Page for UCHL1 antibody-C-terminal region (ARP58968_P050)

Researcher: G. Martens and B. Brackeva, Diabetes Research Center, Brussels Free University (VUB)
Application: IHC
Species + Tissue/Cell type: Rat pancreas
Primary antibody dilution: 1:1000
Secondary antibody: Anti-rabbit-Dylight 548
Secondary antibody dilution: 1:300


Questionnaire:
How do Aviva's reagents play a role in your experimental goals? Antibodies are neede for detection of target protein on immunostaining of human and rat pancreata
How would you rate this antibody on a scale from 1-5 (5=best) and why? 4 Strong staining, low background, HIER needed
Would you use this antibody in future experiments? Yes
Have you used another antibody which has worked in your application? Yes
Do you believe the information about the reagent on Aviva's website is correct? Yes
If the antibody works, do you plan to use it in future experiments or to publish your data? Why or why not? Yes, because of strong staining
How did you store the antibody after re-suspension?  -20 d C
Sample Description (please include 1) species type, and 2) cell/tissue type, and 3) how much protein loaded for each lane of your gel): Tisuue samples of human pancreas and rat pancreas
Please explain fixation solution/method used (formalin, perodate-lysine-paraformaldehyde, acetone, etc.)? Fixation with 10% formalin and Embedding in paraffine
How many different experimental trials were conducted using the antibody sample? 2
Primary antibody dilution, incubation time and temperature: Dilution 1/1000; incubation overnight at 4 d C in wet chamber
Secondary antibody used, dilution, incubation time and temperature: Donkey anti-rabbit IgG Dylight 548 by Jackjon Immunoresearch; dilution 1/300; incubation for 1h at room temperature in wet chamber
From your IHC/ICC images, briefly explain the colors of each stain and counterstain: UCHL-1 in green, Dapi in white, positive controls for pancreata: INS in red, glucagon in blue
Did you use an antigen retrieval method? If so, please explain? HEIR + Citrate or HEIR + EDTA
What controls were used in your experiment? Positive control:INS/GLU-Negative control:no primary Ab-only anti-Rabbit
Please include your detailed tissue preparation and staining procedure/protocol here:
Deparaffinizing - rehydration
* Decreasing alcohol baths
* Toluol x x x Alc 70% H2O
5' 5' 10'' 10'' 10'' 1'
Heat induced epitope retrieval (HIER)
* Steam cooker 2100 Retriever
* R-Buffer A 10x (citrate buffer) PickCell Laboratories cat#30110
100mL = 10mL + 90mL PBS
* 20' + 20' cooldown in the steamcooker
Blocking
* 10% Donkey serum
4000 uL = 400 uL + 3600 uL PBS
* Add 150uL dropwise to the slides
WASH
* Tap the slides gently on papertissue
* Put them in a glass holder filled with PBS for 2'
* Tap the slides gently and carefully dry the slide with papertissue -without touching the tissue-
Detection with Primary Abs
rabbit anti-UCHL1 Aviva Biosystems ARP59268
stock conc 1000.00 ug/mL
dilution 1000
final conc 1.00 ug/mL
rabbit anti-UCHL1 Aviva Biosystems ARP59285
stock conc 1000.00 ug/mL
dilution 1000
final conc 1.00 ug/mL
guinea-pig anti-INS in house
dilution 1000
predilution 100
rest dilution 10
mouse anti-GLU
predilution 40
rest dilution 100
UCH-L1 INS GLU
ARP59268 1000 uL = 1.0 uL 100.0 uL 10.0 uL 889 uL PBS
ARP59285 1000 uL = 1.0 uL 100.0 uL 10.0 uL 889 uL PBS
* <200uL per slide
* ON@4°C in wet chamber
WASH
* Tap the slides gently on papertissue
* Put them in a glass holder filled with PBS for 2'
* Tap the slides gently and carefully dry the slide with papertissue -without touching the tissue-
Detection with secondary Abs
donkey anti-Rabbit IgG Dylight 549 >UCH-L1 Jackson Immunoresearch
dilution 300
donkey anti-mouse IgG Dylight 488 >GLU Jackson Immunoresearch
dilution 300
donkey anti-GP IgG Dylight 649 >INS Jackson Immunoresearch cat#706-496-148 lot#96682
dilution 300
Atlas 300 uL = 1.0 uL 1.0 uL 1.0 uL 297 uL PBS
* 200uL per slide
* 60'@RT in wet chamber
WASH
* Tap the slides gently on papertissue
* Put them in a glass holder filled with PBS for 2'
* Tap the slides gently and carefully dry the slide with papertissue -without touching the tissue-
Stabilizing with mounting medium + DAPI
Dako Fluorescent Mounting Medium +DAPI (inhouse added) Dako cat#2010-10 lot#10036464
* One drop per slide
* Finish with cover slip
* Slides are analysed with Zeis Axioplan 2 Imaging
0
0
Reply
Show more comments (-2) Hide comments
02/01/2017 16:24
  • Overall Experience:
  • Quality:
Product Review: UCHL1 antibody-C-terminal region (ARP58968_P050) in Rat pancreas using IHC
Product Page for UCHL1 antibody-C-terminal region (ARP58968_P050)

Researcher: G. Martens and B. Brackeva, Diabetes Research Center, Brussels Free University (VUB)
Application: IHC
Species + Tissue/Cell type: Rat pancreas
Primary antibody dilution: 1:1000
Secondary antibody: Anti-rabbit-Dylight 548
Secondary antibody dilution: 1:300


Questionnaire:
How do Aviva's reagents play a role in your experimental goals? Antibodies are neede for detection of target protein on immunostaining of human and rat pancreata
How would you rate this antibody on a scale from 1-5 (5=best) and why? 4 Strong staining, low background, HIER needed
Would you use this antibody in future experiments? Yes
Have you used another antibody which has worked in your application? Yes
Do you believe the information about the reagent on Aviva's website is correct? Yes
If the antibody works, do you plan to use it in future experiments or to publish your data? Why or why not? Yes, because of strong staining
How did you store the antibody after re-suspension?  -20 d C
Sample Description (please include 1) species type, and 2) cell/tissue type, and 3) how much protein loaded for each lane of your gel): Tisuue samples of human pancreas and rat pancreas
Please explain fixation solution/method used (formalin, perodate-lysine-paraformaldehyde, acetone, etc.)? Fixation with 10% formalin and Embedding in paraffine
How many different experimental trials were conducted using the antibody sample? 2
Primary antibody dilution, incubation time and temperature: Dilution 1/1000; incubation overnight at 4 d C in wet chamber
Secondary antibody used, dilution, incubation time and temperature: Donkey anti-rabbit IgG Dylight 548 by Jackjon Immunoresearch; dilution 1/300; incubation for 1h at room temperature in wet chamber
From your IHC/ICC images, briefly explain the colors of each stain and counterstain: UCHL-1 in green, Dapi in white, positive controls for pancreata: INS in red, glucagon in blue
Did you use an antigen retrieval method? If so, please explain? HEIR + Citrate or HEIR + EDTA
What controls were used in your experiment? Positive control:INS/GLU-Negative control:no primary Ab-only anti-Rabbit
Please include your detailed tissue preparation and staining procedure/protocol here:
Deparaffinizing - rehydration
* Decreasing alcohol baths
* Toluol x x x Alc 70% H2O
5' 5' 10'' 10'' 10'' 1'
Heat induced epitope retrieval (HIER)
* Steam cooker 2100 Retriever
* R-Buffer A 10x (citrate buffer) PickCell Laboratories cat#30110
100mL = 10mL + 90mL PBS
* 20' + 20' cooldown in the steamcooker
Blocking
* 10% Donkey serum
4000 uL = 400 uL + 3600 uL PBS
* Add 150uL dropwise to the slides
WASH
* Tap the slides gently on papertissue
* Put them in a glass holder filled with PBS for 2'
* Tap the slides gently and carefully dry the slide with papertissue -without touching the tissue-
Detection with Primary Abs
rabbit anti-UCHL1 Aviva Biosystems ARP59268
stock conc 1000.00 ug/mL
dilution 1000
final conc 1.00 ug/mL
rabbit anti-UCHL1 Aviva Biosystems ARP59285
stock conc 1000.00 ug/mL
dilution 1000
final conc 1.00 ug/mL
guinea-pig anti-INS in house
dilution 1000
predilution 100
rest dilution 10
mouse anti-GLU
predilution 40
rest dilution 100
UCH-L1 INS GLU
ARP59268 1000 uL = 1.0 uL 100.0 uL 10.0 uL 889 uL PBS
ARP59285 1000 uL = 1.0 uL 100.0 uL 10.0 uL 889 uL PBS
* <200uL per slide
* ON@4°C in wet chamber
WASH
* Tap the slides gently on papertissue
* Put them in a glass holder filled with PBS for 2'
* Tap the slides gently and carefully dry the slide with papertissue -without touching the tissue-
Detection with secondary Abs
donkey anti-Rabbit IgG Dylight 549 >UCH-L1 Jackson Immunoresearch
dilution 300
donkey anti-mouse IgG Dylight 488 >GLU Jackson Immunoresearch
dilution 300
donkey anti-GP IgG Dylight 649 >INS Jackson Immunoresearch cat#706-496-148 lot#96682
dilution 300
Atlas 300 uL = 1.0 uL 1.0 uL 1.0 uL 297 uL PBS
* 200uL per slide
* 60'@RT in wet chamber
WASH
* Tap the slides gently on papertissue
* Put them in a glass holder filled with PBS for 2'
* Tap the slides gently and carefully dry the slide with papertissue -without touching the tissue-
Stabilizing with mounting medium + DAPI
Dako Fluorescent Mounting Medium +DAPI (inhouse added) Dako cat#2010-10 lot#10036464
* One drop per slide
* Finish with cover slip
* Slides are analysed with Zeis Axioplan 2 Imaging
0
0
Reply
Show more comments (-2) Hide comments
02/01/2017 16:24
  • Overall Experience:
  • Quality:
Product Review: UCHL1 antibody-C-terminal region (ARP58968_P050) in rat INS1 cells using Western blot
Product Page for UCHL1 antibody-C-terminal region (ARP58968_P050)

Researcher: Benedich Bracleva, VUB, Universitair Ziekenhuis Brussel
Application: Western blotting
Species + Tissue/Cell type: Lane 1: 75,000 rat INS1 cells
Primary antibody dilution: 1:1000
Secondary antibody: Anti rabbit-HRP
Secondary antibody dilution: 1:1000


Questionnaire:
How do Aviva's reagents play a role in your experimental goals? Antibodies are needed for detection of target protein on Western Blot.
How would you rate this antibody on a scale from 1-5 (5=best) and why? 5
Would you use this antibody in future experiments? Yes
Have you used another antibody which has worked in your application? Yes
Do you believe the information about the reagent on Aviva's website is correct? Yes
If the antibody works, do you plan to use it in future experiments or to publish your data? Why or why not? Yes
How did you store the antibody after re-suspension?  -20 d C
Sample Description (please include 1) species type, and 2) cell/tissue type, and 3) how much protein loaded for each lane of your gel): Rat INS-1 cell line 75K
How many different experimental trials were conducted using the antibody sample? 2
How was this sample prepared? Washed INS-1 cell pellet is resuspended in RIPA lysis buffer (with protein inhibitor cocktail) at a concentration of 10K/uL, sample was centrifuged at 14000rpm for 10min to remove cells/debris, supernatant (lysate) was transferred to clean tube.
Primary antibody dilution and incubation time: 1/1000 in 20% blocking buffer (Blocking buffer = 5g milk powder + 5mL TBS (20x) + 5mL mQ + 200uL Tween 20) overnight at 4 d C
Secondary antibody used and dilution and incubation time: Donkey anti-rabbit IgG HRP 1/1000 in 20% blocking buffer 1 hour at room temperature
What controls were used in your experiment (positive/negative)? None
Please include your detailed WB Procedure/Protocol here: Gel preparation:
NuPAGE Novex 10% Bis-Tris Midi Gel (1.0mm*15well) Invitrogen cat#NP0303box
1x SDS Running buffer = 50mL 20xMOPS SDS running buffer + 950mL MQRunning of the gel 55' RT
Dry Blotting 7' RT
Blocking 60' RT shaking
Detection with primary Abs ON 4 d C shaking
Wash with TNT 3x 10' RT shaking
Detection with secondary Abs 60' RT shaking
Wash with TNT 3x 10' RT shaking
Development
0
0
Reply
Show more comments (-2) Hide comments

4 Item(s)

What kind of abuse are you reporting?
    Please, wait...