Now Offering Over 102,157 Antibodies & 44,722 Antigens!

TUBE1 antibody - middle region (ARP56869_P050)

100 ul

Regular Price: $289.00

Special Price: $215.00

In Stock

Conjugation Options

ARP56869_P050-FITC Conjugated

ARP56869_P050-HRP Conjugated

ARP56869_P050-Biotin Conjugated

Gene Symbol:
TUBE1
NCBI Gene Id:
51175
Official Gene Full Name:
Tubulin, epsilon 1
Protein Name:
Tubulin epsilon chain
Swissprot Id:
Q9UJT0
Protein Accession #:
NP_057346
Nucleotide Accession #:
NM_016262
Alias Symbols:
FLJ22589, TUBE, dJ142L7.2
Replacement Item:
This antibody may replace item sc-10471 from Santa Cruz Biotechnology.
Description of Target:
This gene encodes a member of the tubulin superfamily. This protein localizes to the centriolar sub-distal appendages that are associated with the older of the two centrioles after centrosome duplication. This protein plays a central role in organization
Protein Size (# AA):
475
Molecular Weight:
53kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express TUBE1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express TUBE1.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human TUBE1
Species Reactivity:
Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Predicted Homology Based on Immunogen Sequence:
Dog: 85%; Guinea Pig: 100%; Horse: 86%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%
Complete computational species homology data:
Anti-TUBE1 (ARP56869_P050)
Peptide Sequence:
Synthetic peptide located within the following region: HLHHYLQVEGMEESCFTEAVSSLSALIQEYDQLDATKNMPVQDLPRLSIA
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
UBC; IGSF8; ICAM1; CD81;
Blocking Peptide:
For anti-TUBE1 (ARP56869_P050) antibody is Catalog # AAP56869 (Previous Catalog # AAPP39816)
Datasheets/Manuals:
Printable datasheet for anti-TUBE1 (ARP56869_P050) antibody
Target Reference:
Chang,P. (2000) Nat. Cell Biol. 2 (1), 30-35

Tell us what you think about this item!

Write A Review
    Please, wait...