Now Offering Over 102,157 Antibodies & 44,722 Antigens!

TRPV4 antibody - middle region (ARP35416_P050)

100 ul

Regular Price: $289.00

Special Price: $215.00

In Stock

Conjugation Options

ARP35416_P050-FITC Conjugated

ARP35416_P050-HRP Conjugated

ARP35416_P050-Biotin Conjugated

Gene Symbol:
TRPV4
NCBI Gene Id:
59341
Official Gene Full Name:
Transient receptor potential cation channel, subfamily V, member 4
Protein Name:
Transient receptor potential cation channel subfamily V member 4
Swissprot Id:
Q9HBA0-2
Protein Accession #:
NP_671737
Nucleotide Accession #:
NM_147204
Alias Symbols:
OTRPC4, TRP12, VR-OAC, VRL-2, VRL2, VROAC, CMT2C, SPSMA, HMSN2C, SSQTL1
Replacement Item:
This antibody may replace item sc-16485 from Santa Cruz Biotechnology.
Description of Target:
TRPV4 is a member of the OSM9-like transient receptor potential channel (OTRPC) subfamily in the transient receptor potential (TRP) superfamily of ion channels. TRPV4 is a Ca2+-permeable, nonselective cation channel that is thought to be involved in the regulation of systemic osmotic pressure.This gene encodes a member of the OSM9-like transient receptor potential channel (OTRPC) subfamily in the transient receptor potential (TRP) superfamily of ion channels. The encoded protein is a Ca2+-permeable, nonselective cation channel that is thought to be involved in the regulation of systemic osmotic pressure. Two transcript variants encoding different isoforms have been found for this gene.
Protein Size (# AA):
811
Molecular Weight:
91kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express TRPV4.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express TRPV4.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human TRPV4
Species Reactivity:
Cow, Dog, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 86%; Guinea Pig: 86%; Human: 100%; Mouse: 86%; Pig: 93%; Rabbit: 100%; Rat: 93%
Complete computational species homology data:
Anti-TRPV4 (ARP35416_P050)
Peptide Sequence:
Synthetic peptide located within the following region: RVDEVNWSHWNQNLGIINEDPGKNETYQYYGFSHTVGRLRRDRWSSVVPR
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
UBC; ARRB2; KRIT1; ITCH; PACSIN3; PACSIN1; TRPV4; PACSIN2; MAP7; SRC; LYN; YES1; LCK; HCK; FYN; CALM1; OS9; PACS1;
Blocking Peptide:
For anti-TRPV4 (ARP35416_P050) antibody is Catalog # AAP35416 (Previous Catalog # AAPP06654)
Datasheets/Manuals:
Printable datasheet for anti-TRPV4 (ARP35416_P050) antibody
Sample Type Confirmation:

TRPV4 is supported by BioGPS gene expression data to be expressed in PANC1

Target Reference:
Fischer,W.H. (er) Pflugers Arch. (2008) In press
Publications:

Sampat, S. R. et al. Applied osmotic loading for promoting development of engineered cartilage. J. Biomech. 46, 2674-81 (2013). IHC, WB, Cow, Dog, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat 24035014

Tell us what you think about this item!

Write A Review
    Please, wait...