Now Offering Over 102,157 Antibodies & 44,722 Antigens!

TRPV4 antibody - middle region (ARP35330_P050)

100 ul

Regular Price: $289.00

Special Price: $215.00

In Stock

Conjugation Options

ARP35330_P050-FITC Conjugated

ARP35330_P050-HRP Conjugated

ARP35330_P050-Biotin Conjugated

Gene Symbol:
TRPV4
NCBI Gene Id:
59341
Official Gene Full Name:
Transient receptor potential cation channel, subfamily V, member 4
Protein Name:
Transient receptor potential cation channel subfamily V member 4
Swissprot Id:
Q9HBA0-2
Protein Accession #:
NP_671737
Nucleotide Accession #:
NM_147204
Alias Symbols:
OTRPC4, TRP12, VR-OAC, VRL-2, VRL2, VROAC, CMT2C, SPSMA, HMSN2C, SSQTL1
Replacement Item:
This antibody may replace item sc-16485 from Santa Cruz Biotechnology.
Description of Target:
TRPV4 is a non-selective calcium permeant cation channel probably involved in osmotic sensitivity and mechanosensitivity. Activation of TRPV4 by exposure to hypotonicity within the physiological range exhibits an outward rectification. TRPV4 also activated by low pH, citrate and phorbol esters and increase of intracellular Ca2+ potentiates currents. Channel activity seems to be regulated by a calmodulin-dependent mechanism with a negative feedback mechanism.Defects in TRPV4 are the cause of brachyolmia type 3 (BRAC3) This gene encodes a member of the OSM9-like transient receptor potential channel (OTRPC) subfamily in the transient receptor potential (TRP) superfamily of ion channels. The encoded protein is a Ca2+-permeable, nonselective cation channel that is thought to be involved in the regulation of systemic osmotic pressure. Two transcript variants encoding different isoforms have been found for this gene.
Protein Size (# AA):
811
Molecular Weight:
91kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express TRPV4.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express TRPV4.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human TRPV4
Species Reactivity:
Cow, Dog, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 86%; Guinea Pig: 86%; Human: 100%; Mouse: 86%; Pig: 93%; Rabbit: 100%; Rat: 93%
Complete computational species homology data:
Anti-TRPV4 (ARP35330_P050)
Peptide Sequence:
Synthetic peptide located within the following region: RVDEVNWSHWNQNLGIINEDPGKNETYQYYGFSHTVGRLRRDRWSSVVPR
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
UBC; ARRB2; KRIT1; ITCH; PACSIN3; PACSIN1; TRPV4; PACSIN2; MAP7; SRC; LYN; YES1; LCK; HCK; FYN; CALM1; OS9; PACS1;
Blocking Peptide:
For anti-TRPV4 (ARP35330_P050) antibody is Catalog # AAP35330 (Previous Catalog # AAPP06566)
Datasheets/Manuals:
Printable datasheet for anti-TRPV4 (ARP35330_P050) antibody
Target Reference:
Corey,D.P. (er) Pflugers Arch. (2008) In press

Tell us what you think about this item!

Write A Review
    Please, wait...