Now Offering Over 102,157 Antibodies & 44,722 Antigens!

TRPC6 antibody - middle region (ARP35144_P050)

100 ul

Regular Price: $289.00

Special Price: $215.00

In Stock

Conjugation Options

ARP35144_P050-FITC Conjugated

ARP35144_P050-HRP Conjugated

ARP35144_P050-Biotin Conjugated

Gene Symbol:
TRPC6
NCBI Gene Id:
7225
Official Gene Full Name:
Transient receptor potential cation channel, subfamily C, member 6
Protein Name:
Short transient receptor potential channel 6
Swissprot Id:
Q9Y210
Protein Accession #:
NP_004612
Nucleotide Accession #:
NM_004621
Alias Symbols:
FLJ11098, FLJ14863, FSGS2, TRP6
Replacement Item:
This antibody may replace item sc-15056 from Santa Cruz Biotechnology.
Description of Target:
TRPC6 forms a receptor-activated calcium channel in the cell membrane. The channel is activated by diacylglycerol and is thought to be under the control of a phosphatidylinositol second messenger system. Activation of this channel occurs independently of protein kinase C and is not triggered by low levels of intracellular calcium. Defects in this gene are a cause of focal segmental glomerulosclerosis 2 (FSGS2).
Protein Size (# AA):
931
Molecular Weight:
106kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express TRPC6.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express TRPC6.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human TRPC6
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rat, Yeast
Predicted Homology Based on Immunogen Sequence:
Cow: 92%; Dog: 92%; Guinea Pig: 92%; Horse: 92%; Human: 100%; Mouse: 85%; Pig: 100%; Rat: 77%; Yeast: 86%
Complete computational species homology data:
Anti-TRPC6 (ARP35144_P050)
Peptide Sequence:
Synthetic peptide located within the following region: KKGFQEDAEMNKINEEKKLGILGSHEDLSKLSLDKKQVGHNKQPSIRSSE
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
RNF24; TRPC3; ORAI1; TRPM2; TRPC6; SRC; ITPR3; MX1; FYN; TRPC7; TRPC5; TRPC4; TRPC1; TRPC2; ITPR1;
Blocking Peptide:
For anti-TRPC6 (ARP35144_P050) antibody is Catalog # AAP35144 (Previous Catalog # AAPP08603)
Datasheets/Manuals:
Printable datasheet for anti-TRPC6 (ARP35144_P050) antibody
Target Reference:
Liu,D., (2008) Arterioscler. Thromb. Vasc. Biol. 28 (4), 746-751

Tell us what you think about this item!

Write A Review
    Please, wait...