Now Offering Over 102,157 Antibodies & 44,722 Antigens!

TP53 antibody - N-terminal region (ARP30307_P050)

Scroll Horizontally to view all Images
Print Page
  • Let us Help: Ask a Question
100 ul

Regular Price: $289.00

Special Price: $215.00

In Stock

Conjugation Options

ARP30307_P050-FITC Conjugated

ARP30307_P050-HRP Conjugated

ARP30307_P050-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Protein Name:
Cellular tumor antigen p53
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
LFS1, TRP53, p53
Replacement Item:
This antibody may replace item sc-126 from Santa Cruz Biotechnology.
Description of Target:
TP53 acts as a tumor suppressor in many tumor types; induces growth arrest or apoptosis depending on the physiological circumstances and cell type. Involved in cell cycle regulation as a trans-activator that acts to negatively regulate cell division by controlling a set of genes required for this process. This gene encodes tumor protein p53, which responds to diverse cellular stresses to regulate target genes that induce cell cycle arrest, apoptosis, senescence, DNA repair, or changes in metabolism. p53 protein is expressed at low level in normal cells and at a high level in a variety of transformed cell lines, where it's believed to contribute to transformation and malignancy. p53 is a DNA-binding protein containing transcription activation, DNA-binding, and oligomerization domains. It is postulated to bind to a p53-binding site and activate expression of downstream genes that inhibit growth and/or invasion, and thus function as a tumor suppressor. Mutants of p53 that frequently occur in a number of different human cancers fail to bind the consensus DNA binding site, and hence cause the loss of tumor suppressor activity. Alterations of this gene occur not only as somatic mutations in human malignancies, but also as germline mutations in some cancer-prone families with Li-Fraumeni syndrome. Multiple p53 variants due to alternative promoters and multiple alternative splicing have been found. These variants encode distinct isoforms, which can regulate p53 transcriptional activity.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express TP53.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express TP53.
The immunogen is a synthetic peptide directed towards the N terminal region of human TP53
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Pig, Rabbit, Rat, Sheep
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 80%; Guinea Pig: 90%; Horse: 90%; Human: 100%; Pig: 100%; Rabbit: 100%; Rat: 90%; Sheep: 100%
Complete computational species homology data:
Anti-TP53 (ARP30307_P050)
Peptide Sequence:
Synthetic peptide located within the following region: EEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIE
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-TP53 (ARP30307_P050) antibody is Catalog # AAP30307 (Previous Catalog # AAPS08710)
Datasheets / Downloads:
Printable datasheet for anti-TP53 (ARP30307_P050) antibody
Sample Type Confirmation:

TP53 is strongly supported by BioGPS gene expression data to be expressed in 721_B, HEK293T

Additional Information:
IHC Information: Skin
IHC Information: Kidney
Target Reference:
Boehme,K.A., (2008) Proc. Natl. Acad. Sci. U.S.A. 105 (22), 7785-7790
Additional Product Images:

Customer Reviews for TP53 Antibody (ARP30307_P050) tested with U20S, PLKO cells in Chromatin Immunoprecipitation

-submitted by Nick Barlev
University of Leicester

U20S (p53+) cells were treated with 0.5 uM Doxorubicin for 14 hrs to induce DNA damage and hence activate p53. In parallel, PLKO cells (U2OS cells with stable shRNA-mediated knockdown of p53) were treated similarly and were used as negative control. The data for p21 promoter were normalised to actin (control for non-specific binding of DNA to the antibodies).

Product Protocols: TP53 antibody tested with Human 293T Cells (ARP30307_P050)

Aviva Systems Biology is the original manufacturer of this TP53 antibody (ARP30307_P050)

Click here to view the TP53 antibody Western Blot Protocol

Product Datasheet Link: TP53 antibody (ARP30307_P050)

WB Suggested Anti-TP53 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: 293T

Western Blot image:

Description of Target: TP53 acts as a tumor suppressor in many tumor types; induces growth arrest or apoptosis depending on the physiological circumstances and cell type. Involved in cell cycle regulation as a trans-activator that acts to negatively regulate cell division by controlling a set of genes required for this process. This gene encodes tumor protein p53, which responds to diverse cellular stresses to regulate target genes that induce cell cycle arrest, apoptosis, senescence, DNA repair, or changes in metabolism. p53 protein is expressed at low level in normal cells and at a high level in a variety of transformed cell lines, where it's believed to contribute to transformation and malignancy. p53 is a DNA-binding protein containing transcription activation, DNA-binding, and oligomerization domains. It is postulated to bind to a p53-binding site and activate expression of downstream genes that inhibit growth and/or invasion, and thus function as a tumor suppressor. Mutants of p53 that frequently occur in a number of different human cancers fail to bind the consensus DNA binding site, and hence cause the loss of tumor suppressor activity. Alterations of this gene occur not only as somatic mutations in human malignancies, but also as germline mutations in some cancer-prone families with Li-Fraumeni syndrome. Multiple p53 variants due to alternative promoters and multiple alternative splicing have been found. These variants encode distinct isoforms, which can regulate p53 transcriptional activity.

Questions pertaining to this data can be directed to

Aviva Systems Biology’s TP53 antibody (ARP30307_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at

Product Review: TP53 antibody – N-terminal region (ARP30307_P050) in PLKO AND U2OS cells using ChIp Assays

Product Page Link:  TP53 antibody - N-terminal region (ARP30307_P050)

Data provided by: Dr. Barlev, University of Leicester

Figure 1. Binding of p53-specific antibodies to the p21 promoter. U20S (p53+) cells were treated with 0.5 uM Doxorubicin for 14 hrs to induce DNA damage and hence activate p53. In parallel, PLKO cells (U2OS cells with stable shRNA-mediated knockdown of p53) were treated similarly and were used as negative control. Thedata for p21 promoter were normalised to actin (control for non-specific binding of DNA to the antibodies).

Product Protocol: TP53 Antibody (ARP30307_P050) in Human Lymph Node Tissue using Immunohistochemistry

Aviva Systems Biology is the original manufacturer of this TP53 antibody.
Product Datasheet Link: TP53 antibody ARP30307_P050

Rabbit Anti-TP53 Antibody
Catalog Number: ARP30307_P050
Formalin Fixed Paraffin Embedded Tissue: Human Lymph Node Tissue
Observed Staining: Nucleus, Cytoplasm
Primary Antibody Concentration: 1:100
Other Working Concentrations: 1:600
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20X
Exposure Time: 0.5 - 2.0 sec

Left to right:
DAPI, TP53 Ab, Merge

Control Image:
Control Antibody: Normal Rabbit IgG
Control Antibody Concentration: 1:100

Left to right:
DAPI, Rabbit IgG, Merge

1. Normal adult human lymph node tissue was formalin fixed, embedded in paraffin wax, sectioned at 6 micron thickness and put on histological slides.
2. After deparaffinization and rehydration, the low pH, heat-induced antigen retrieval method utilizing Sodium Citrate buffer was performed.
3. The blocking buffer was 5% normal goat serum.
4. Primary antibodies was diluted in antibody dilution buffer (1% Normal Donkey Serum) to the final testing dilution (1:100, 1:600, 1:1200).
5. The appropriate anti-rabbit fluorescent-conjugated (Rhodamine:red or FITC:green) secondary antibody was applied and nuclei will be counterstained with DAPI (blue).
6. A Negative control utilized a nonspecific rabbit IgG staining the same normal adult human lymph node tissue.

Ask a Question

Tell us what you think about this item!

Write A Review
    Please, wait...