Now Offering Over 102,157 Antibodies & 44,722 Antigens!

TP53 antibody - N-terminal region (ARP30307_P050)

100 ul

Regular Price: $289.00

Special Price: $215.00

In Stock

Conjugation Options

ARP30307_P050-FITC Conjugated

ARP30307_P050-HRP Conjugated

ARP30307_P050-Biotin Conjugated

Gene Symbol:
TP53
NCBI Gene Id:
7157
Protein Name:
Cellular tumor antigen p53
Swissprot Id:
P04637
Protein Accession #:
NP_000537
Nucleotide Accession #:
NM_000546
Alias Symbols:
LFS1, TRP53, p53
Replacement Item:
This antibody may replace item sc-126 from Santa Cruz Biotechnology.
Description of Target:
TP53 acts as a tumor suppressor in many tumor types; induces growth arrest or apoptosis depending on the physiological circumstances and cell type. Involved in cell cycle regulation as a trans-activator that acts to negatively regulate cell division by controlling a set of genes required for this process. This gene encodes tumor protein p53, which responds to diverse cellular stresses to regulate target genes that induce cell cycle arrest, apoptosis, senescence, DNA repair, or changes in metabolism. p53 protein is expressed at low level in normal cells and at a high level in a variety of transformed cell lines, where it's believed to contribute to transformation and malignancy. p53 is a DNA-binding protein containing transcription activation, DNA-binding, and oligomerization domains. It is postulated to bind to a p53-binding site and activate expression of downstream genes that inhibit growth and/or invasion, and thus function as a tumor suppressor. Mutants of p53 that frequently occur in a number of different human cancers fail to bind the consensus DNA binding site, and hence cause the loss of tumor suppressor activity. Alterations of this gene occur not only as somatic mutations in human malignancies, but also as germline mutations in some cancer-prone families with Li-Fraumeni syndrome. Multiple p53 variants due to alternative promoters and multiple alternative splicing have been found. These variants encode distinct isoforms, which can regulate p53 transcriptional activity.
Protein Size (# AA):
393
Molecular Weight:
44kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
CHIP, IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express TP53.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express TP53.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human TP53
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Pig, Rabbit, Rat, Sheep
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 80%; Guinea Pig: 90%; Horse: 90%; Human: 100%; Pig: 100%; Rabbit: 100%; Rat: 90%; Sheep: 100%
Complete computational species homology data:
Anti-TP53 (ARP30307_P050)
Peptide Sequence:
Synthetic peptide located within the following region: EEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIE
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-TP53 (ARP30307_P050) antibody is Catalog # AAP30307 (Previous Catalog # AAPS08710)
Datasheets/Manuals:
Printable datasheet for anti-TP53 (ARP30307_P050) antibody
Sample Type Confirmation:

TP53 is strongly supported by BioGPS gene expression data to be expressed in 721_B, HEK293T

Additional Information:
IHC Information: Skin
IHC Information: Kidney
Target Reference:
Boehme,K.A., (2008) Proc. Natl. Acad. Sci. U.S.A. 105 (22), 7785-7790

Tell us what you think about this item!

Write A Review
    Please, wait...