Now Offering Over 102,157 Antibodies & 44,722 Antigens!

TNFSF10 antibody - N-terminal region (AVARP02040_P050)

100 ul

Regular Price: $289.00

Special Price: $215.00

In Stock

Conjugation Options

AVARP02040_P050-FITC Conjugated

AVARP02040_P050-HRP Conjugated

AVARP02040_P050-Biotin Conjugated

Gene Symbol:
TNFSF10
NCBI Gene Id:
8743
Official Gene Full Name:
Tumor necrosis factor (ligand) superfamily, member 10
Protein Name:
Tumor necrosis factor ligand superfamily member 10
Swissprot Id:
P50591
Protein Accession #:
NP_003801
Nucleotide Accession #:
NM_003810
Alias Symbols:
TL2, APO2L, CD253, TRAIL, Apo-2L
Replacement Item:
This antibody may replace item sc-170196 from Santa Cruz Biotechnology.
Description of Target:
TNFSF10 is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This protein preferentially induces apoptosis in transformed and tumor cells, but does not appear to kill normal cells although it is expressed at a significant level in most normal tissues. This protein binds to several members of TNF receptor superfamily including TNFRSF10A/TRAILR1, TNFRSF10B/TRAILR2, TNFRSF10C/TRAILR3, TNFRSF10D/TRAILR4, and possibly also to TNFRSF11B/OPG. The activity of this protein may be modulated by binding to the decoy receptors TNFRSF10C/TRAILR3, TNFRSF10D/TRAILR4, and TNFRSF11B/OPG that cannot induce apoptosis. The binding of this protein to its receptors has been shown to trigger the activation of MAPK8/JNK, caspase 8, and caspase 3.
Protein Size (# AA):
281
Molecular Weight:
33kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express TNFSF10.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express TNFSF10.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human TNFSF10
Species Reactivity:
Dog, Human, Pig
Predicted Homology Based on Immunogen Sequence:
Dog: 80%; Human: 100%; Pig: 78%
Complete computational species homology data:
Anti-TNFSF10 (AVARP02040_P050)
Peptide Sequence:
Synthetic peptide located within the following region: CFLKEDDSYWDPNDEESMNSPCWQVKWQLRQLVRKMILRTSEETISTVQE
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
CASP8; CASP3; CFLAR; TNFRSF10B; FADD; RIPK1; TRAF2; TNFAIP3; SOCS3; RBM48; TNFRSF10D; TNFRSF10C; TNFRSF10A; TNFSF10; TNFRSF11B; ACP5; IER3; CREBBP; SP3; SP1; HDAC5; HDAC4; HDAC3; HDAC2; HDAC1; HIST3H3;
Blocking Peptide:
For anti-TNFSF10 (AVARP02040_P050) antibody is Catalog # AAP30629 (Previous Catalog # AAPP01282)
Datasheets/Manuals:
Printable datasheet for anti-TNFSF10 (AVARP02040_P050) antibody
Target Reference:
Wu,Y.Y., et al., (2004) World J. Gastroenterol. 10 (16), 2334-2339
Publications:

Ceballos, M. P. et al. FoxO3a Nuclear Localization and Its Association with β-Catenin and Smads in IFN--alpha-Treated Hepatocellular Carcinoma Cell Lines. J. Interferon Cytokine Res. (2014). doi:10.1089/jir.2013.0124 WB, Dog, Human, Pig 24950290

Tell us what you think about this item!

Write A Review
    Please, wait...