Now Offering Over 102,157 Antibodies & 44,722 Antigens!

TNFRSF1A antibody - N-terminal region (AVARP00034_P050)

100 ul

Regular Price: $289.00

Special Price: $215.00

In Stock

Conjugation Options

AVARP00034_P050-FITC Conjugated

AVARP00034_P050-HRP Conjugated

AVARP00034_P050-Biotin Conjugated

Gene Symbol:
TNFRSF1A
NCBI Gene Id:
7132
Official Gene Full Name:
Tumor necrosis factor receptor superfamily, member 1A
Protein Name:
Tumor necrosis factor receptor superfamily member 1A
Swissprot Id:
P19438
Protein Accession #:
NP_001056
Nucleotide Accession #:
NM_001065
Alias Symbols:
CD120a, FPF, MGC19588, TBP1, TNF-R, TNF-R-I, TNF-R55, TNFAR, TNFR1, TNFR55, TNFR60, p55, p55-R, p60
Replacement Item:
This antibody may replace item sc-1067 from Santa Cruz Biotechnology.
Description of Target:
TNFRSF1A is the receptor for TNFSF2/TNF-alpha and homotrimeric TNFSF1/lymphotoxin-alpha. The adapter molecule FADD recruits caspase-8 to the activated receptor. The resulting death-inducing signaling complex (DISC) performs caspase-8 proteolytic activation which initiates the subsequent cascade of caspases (aspartate-specific cysteine proteases) mediating apoptosis. TNFRSF1A contributes to the induction of non-cytocidal TNF effects including anti-viral state and activation of the acid sphingomyelinase.The protein encoded by this gene is a member of the TNF-receptor superfamily. This protein is one of the major receptors for the tumor necrosis factor-alpha. This receptor can activate NF-kappaB, mediate apoptosis, and function as a regulator of inflammation. Antiapoptotic protein BCL2-associated athanogene 4 (BAG4/SODD) and adaptor proteins TRADD and TRAF2 have been shown to interact with this receptor, and thus play regulatory roles in the signal transduction mediated by the receptor. Germline mutations of the extracellular domains of this receptor were found to be associated with the autosomal dominant periodic fever syndrome. The impaired receptor clearance is thought to be a mechanism of the disease. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Protein Size (# AA):
455
Molecular Weight:
48kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
IF, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express TNFRSF1A.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express TNFRSF1A.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human TNFRSF1A
Species Reactivity:
Guinea Pig, Human, Mouse
Predicted Homology Based on Immunogen Sequence:
Guinea Pig: 84%; Human: 100%; Mouse: 92%
Complete computational species homology data:
Anti-TNFRSF1A (AVARP00034_P050)
Peptide Sequence:
Synthetic peptide located within the following region: MGLSTVPDLLLPLVLLELLVGIYPSGVIGLVPHLGDREKRDSVCPQGKYI
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
RIPK1; UBC; UCHL1; TNF; STAMBP; RNF8; TRAF2; TRADD; ADAM17; LTA; SRC; SHARPIN; KHDRBS1; IKBKB; CHUK; MAP3K7; PPP1CA; PIK3R1; JAK2; ATF6; PRDX3; OPTN; FADD; TNFRSF1A; SGTA; PRKCD; PRKCB; HRG; GYS2; BIRC2; UBQLN1; MAGEH1; SOS1; MYOC; GRB2; DAXX; BIRC3; Traf
Blocking Peptide:
For anti-TNFRSF1A (AVARP00034_P050) antibody is Catalog # AAP30521 (Previous Catalog # AAPP01157)
Datasheets/Manuals:
Printable datasheet for anti-TNFRSF1A (AVARP00034_P050) antibody
Sample Type Confirmation:

TNFRSF1A is supported by BioGPS gene expression data to be expressed in DU145

Target Reference:
Gattorno,M., (2008) Arthritis Rheum. 58 (6), 1823-1832

Tell us what you think about this item!

Write A Review
    Please, wait...