Now Offering Over 102,157 Antibodies & 44,722 Antigens!

TMTC1 antibody - middle region (ARP49127_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
$289.00
In Stock

Conjugation Options

ARP49127_P050-FITC Conjugated

ARP49127_P050-HRP Conjugated

ARP49127_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
TMTC1
NCBI Gene Id:
83857
Official Gene Full Name:
Transmembrane and tetratricopeptide repeat containing 1
Protein Name:
Transmembrane and TPR repeat-containing protein 1
Swissprot Id:
Q8IUR5
Protein Accession #:
NP_787057
Nucleotide Accession #:
NM_175861
Alias Symbols:
ARG99, FLJ31400, FLJ41625, OLF, TMTC1A
Description of Target:
TMTC1 is a multi-pass membrane protein. It belongs to the TMTC family and contains 10 TPR repeats. The exact function of TMTC1 remains unknown.
Protein Size (# AA):
774
Molecular Weight:
87kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express TMTC1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express TMTC1.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human TMTC1
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 100%; Yeast: 91%
Complete computational species homology data:
Anti-TMTC1 (ARP49127_P050)
Peptide Sequence:
Synthetic peptide located within the following region: GPEFADAYSSLASLLAEQERFKEAEEIYQTGIKNCPDSSDLHNNYGVFLV
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-TMTC1 (ARP49127_P050) antibody is Catalog # AAP49127 (Previous Catalog # AAPY02324)
Datasheets/Manuals:
Printable datasheet for anti-TMTC1 (ARP49127_P050) antibody
Target Reference:
Gerhard,D.S., Genome Res. 14 (10B), 2121-2127 (2004)

Tell us what you think about this item!

Write A Review
    Please, wait...