Now Offering Over 102,157 Antibodies & 44,722 Antigens!

TIMP2 antibody - middle region (ARP59181_P050)

100 ul

Regular Price: $289.00

Special Price: $215.00

In Stock

Conjugation Options

ARP59181_P050-FITC Conjugated

ARP59181_P050-HRP Conjugated

ARP59181_P050-Biotin Conjugated

Gene Symbol:
TIMP2
NCBI Gene Id:
7077
Official Gene Full Name:
TIMP metallopeptidase inhibitor 2
Protein Name:
Metalloproteinase inhibitor 2
Swissprot Id:
P16035
Protein Accession #:
NP_003246
Nucleotide Accession #:
NM_003255
Alias Symbols:
CSC-21K, Timp-2, Metalloproteinase inhibitor 2, TIMP2, TIMP metallopeptidase inhibitor 2, Tissue inhibitor of metalloproteinases 2, Timp2
Replacement Item:
This antibody may replace item sc-21735 from Santa Cruz Biotechnology.
Description of Target:
This gene is a member of the TIMP gene family. The proteins encoded by this gene family are natural inhibitors of the matrix metalloproteinases, a group of peptidases involved in degradation of the extracellular matrix. In addition to an inhibitory role against metalloproteinases, the encoded protein has a unique role among TIMP family members in its ability to directly suppress the proliferation of endothelial cells. As a result, the encoded protein may be critical to the maintenance of tissue homeostasis by suppressing the proliferation of quiescent tissues in response to angiogenic factors, and by inhibiting protease activity in tissues undergoing remodelling of the extracellular matrix.
Protein Size (# AA):
220
Molecular Weight:
24kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express TIMP2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express TIMP2.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human TIMP2
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 100%; Sheep: 100%
Complete computational species homology data:
Anti-TIMP2 (ARP59181_P050)
Peptide Sequence:
Synthetic peptide located within the following region: IVPWDTLSTTQKKSLNHRYQMGCECKITRCPMIPCYISSPDECLWMDWVT
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
BAG3; ITGA3; MMP14; ITGB1; MMP2; MMP8; SNCG; PSMA7;
Blocking Peptide:
For anti-TIMP2 (ARP59181_P050) antibody is Catalog # AAP59181 (Previous Catalog # AAPP45149)
Datasheets/Manuals:
Printable datasheet for anti-TIMP2 (ARP59181_P050) antibody

Tell us what you think about this item!

Write A Review
    Please, wait...