Now Offering Over 102,157 Antibodies & 44,722 Antigens!

THOC1 Antibody - C-terminal region (ARP40578_P050)

100 ul

Regular Price: $289.00

Special Price: $215.00

In Stock

Conjugation Options

ARP40578_P050-FITC Conjugated

ARP40578_P050-HRP Conjugated

ARP40578_P050-Biotin Conjugated

Gene Symbol:
THOC1
NCBI Gene Id:
9984
Official Gene Full Name:
THO complex 1
Protein Name:
THO complex subunit 1
Swissprot Id:
Q96FV9
Protein Accession #:
NP_005122
Nucleotide Accession #:
NM_005131
Alias Symbols:
P84, HPR1, P84N5
Replacement Item:
This antibody may replace item sc-136426 from Santa Cruz Biotechnology.
Description of Target:
HPR1 is part of the TREX (transcription/export) complex, which includes TEX1 (MIM 606929), THO2 (MIM 300395), ALY (MIM 604171), and UAP56 (MIM 142560).[supplied by OMIM, Nov 2010]
Protein Size (# AA):
657
Molecular Weight:
76kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express THOC1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express THOC1.
Immunogen:
The immunogen is a synthetic peptide directed towards the C terminal region of human THOC1
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 77%; Zebrafish: 77%
Complete computational species homology data:
Anti-THOC1 (ARP40578_P050)
Peptide Sequence:
Synthetic peptide located within the following region: TNQQFKSLQEYLENMVIKLAKELPPPSEEIKTGEDEDEEDNDALLKENES
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
USHBP1; MOAP1; TRIM54; RABGEF1; THOC2; SUMO2; UBC; SUMO1; RPA3; RPA2; RPA1; RNF2; FRA10AC1; WDR77; SAP30BP; SF3B2; THOC1; THOC5; IK; DHX8; UBR7; TRMT112; SF3B1; RRP9; USP13; DDX39B; UTRN; TPM3; TPM1; VPS53; ZNF830; THOC3; THOC7; THOC6; XPO4; ZC3H15; ZCCHC
Blocking Peptide:
For anti-THOC1 (ARP40578_P050) antibody is Catalog # AAP40578 (Previous Catalog # AAPP22754)
Datasheets/Manuals:
Printable datasheet for anti-THOC1 (ARP40578_P050) antibody
Subunit:
1
Target Reference:
Li,Y., (2005) Mol. Cell. Biol. 25 (10), 4023-4033

Tell us what you think about this item!

Write A Review
    Please, wait...