Aviva Systems Biology office will be closed for Memorial Holiday - May 28th, 2018.
Please go here for more info.

Now Offering Over 102,157 Antibodies & 44,722 Antigens!

TGFB1 antibody - middle region (ARP37894_P050)

Scroll Horizontally to view all Images


Print Page
100 ul

Regular Price: $289.00

Special Price: $215.00

In Stock

Conjugation Options

ARP37894_P050-FITC Conjugated

ARP37894_P050-HRP Conjugated

ARP37894_P050-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
Transforming growth factor, beta 1
Protein Name:
Transforming growth factor beta-1
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Tgfb, Tgfb-1, TGFbeta1, TGF-beta1
Replacement Item:
This antibody may replace item sc-130348 from Santa Cruz Biotechnology.
Description of Target:
Tgfb1 is a multifunctional protein that control proliferation, differentiation, and other functions in many cell types. Many cells synthesize TGFB1 and essentially all of them have specific receptors for this protein. It regulates the actions of many other growth factors and determines a positive or negative direction of their effects. It plays an important role in bone remodelling. It is a potent stimulator of osteoblastic bone formation, causing chemotaxis, proliferation and differentiation in committed osteoblasts.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express TGFB1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express TGFB1.
The immunogen is a synthetic peptide directed towards the middle region of mouse TGFB1
Species Reactivity:
Cow, Dog, Goat, Guinea Pig, Horse, Mouse, Pig, Rat, Sheep
Predicted Homology Based on Immunogen Sequence:
Cow: 79%; Dog: 79%; Goat: 79%; Guinea Pig: 87%; Horse: 79%; Mouse: 100%; Pig: 93%; Rat: 93%; Sheep: 79%
Complete computational species homology data:
Anti-TGFB1 (ARP37894_P050)
Peptide Sequence:
Synthetic peptide located within the following region: DTPEWLSFDVTGVVRQWLNQGDGIQGFRFSAHCSCDSKDNKLHVEINGIS
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Htra1; Nrep; Ltbp3; Col1a1; Tgfbr3; Tgfbr1; Tgfbr2; Smad4; Hdac3; Jun;
Blocking Peptide:
For anti-TGFB1 (ARP37894_P050) antibody is Catalog # AAP37894 (Previous Catalog # AAPP20016)
Printable datasheet for anti-TGFB1 (ARP37894_P050) antibody
Additional Information:
IHC Information: Human prostate cancer tissue: Formalin-Fixed, Paraffin-Embedded (FFPE)
Target Reference:
Cheon,S.S., (2006) FASEB J. 20 (6), 692-701
Additional Product Images:

Customer Reviews for TGFB1 Antibody (ARP37894_P050) tested with pFA fixed human spleen in Immunohistochemistry

CAT#: ARP37894
TGFB1 Antibody
TGFB1 Antibody IHC
TGFB1 Antibody, rat and mouse tissue

Immunohistochemistry Protocol:

Antibodies were tested in the range of 2 – 20 ug/mL on formaldehyde fixed rat and mouse tissues that were cut into 15 micron thick sections on the cryostat. Incubation with primary antibodies was done overnight at 4°C.

Tissue sections then were washed in PBS (pH7.4) 3 times 15 minutes each and then incubated for 1 hour at room temperature with fluorescent secondary antibodies (e.g. anti-rabbit Cy3, anti-rabbit Cy2) diluted according to manufacture's recommendation.

After that section were washed with PBS (pH7.4) 3 times 15 minutes each and then mounted under coverslips using MVS Pacific anti-fade mounting media (available for OEM) with or without nuclear counterstain (e.g. DAPI).

Each experiment was repeated twice.

Ask a Question
Average Rating:
1 review
5 star
4 star
3 star
2 star
1 star
  • Date - Newest First
  • Date - Newest First
  • Date - Latest First
  • Highest Rated
  • Lowest Rated
  • Most Helpful
  • Ownership

1 Item(s)

02/01/2017 16:23
  • Overall Experience:
  • Quality:
Product Review: TGFB1 antibody - middle region (ARP37894_P050) in mouse forebrain using Western Blot
Product Page for TGFB1 antibody - middle region (ARP37894_P050)

Researcher: Shalaka Wahane, Albert Ludwigs Universität Freiburg
Application: Western blotting
Species + Tissue/Cell type: Mouse forebrain
How many ug's of tissue/cell lysate run on the gel:
1. 10 ug mouse forebrain extract
2. 10 ug mouse forebrain extract
Primary antibody dilution: 1:500
Secondary antibody: Anti-rabbit HRP
Secondary antibody dilution: 1:5000


How would you rate this antibody on a scale from 1-5 (5=best) and why?

4, as although I did see the band at the correct molecular weight, there were a few other non-specific bands as well.

Would you use this antibody in future experiments?

Most probably yes.

Have you used another antibody which has worked in your application?


Do you believe the information about the reagent on Aviva's website is correct?

80% yes.

If the antibody works, do you plan to use it in future experiments or to publish your data?

Why or why not?

Yes, since its an important gene we are studying in the context of our project

How did you store the antibody after re-suspension?


Sample Description (please include 1) species type, and 2) cell/tissue type, and 3) how much protein loaded for each lane of your gel):

1. Mouse. 2. Forebrain total protein extract 3. 20ug per well.

How was this sample prepared?

Complete forebrain tissue homogenised using Ripa Buffer, and sonicated using a Bioruptor.

Primary antibody dilution and incubation time:

1:500, Overnight.

Secondary antibody used and dilution and incubation time:

Anti-rabbitt HRP (Jackson Immunolabs).

What controls were used in your experiment (positive/negative)?

GAPDH used as loading control.

Immuno protocol:

Fresh frozen sections (-20 fridge)

Thaw slide and bake slides 10 minutes in 37C incubator.

Mark slide with hydrophobic pen

Fix section with 4% PFA for 30 min at RT.

PBS for 5 min at RT, 3 times.

Permeabilize sections in 0.1% Triton X/PBS for 30 min, RT.

PBS for 5 min at RT, 3 times

Block with 5% BSA/PBS for 60 min at RT

PBS for 5 min

Primary antibody, overnight at 4C (1% BSA/PBS)

PBS for 5 min at RT, 3 times

Secondary Antibody for 1 hr, RT (dilution in 1% BSA/PBS)

PBS for 5 min at RT, 3 times

Mount with SlowFade
Show more comments (-2) Hide comments

1 Item(s)

What kind of abuse are you reporting?
    Please, wait...