Now Offering Over 102,157 Antibodies & 44,722 Antigens!

TF7L1 Antibody - C-terminal region (ARP30091_P050)

Scroll Horizontally to view all Images
Click here to learn more about Aviva's By-Request Conjugation Service.
Print Page
  • Let us Help: Ask a Question
100 ul
In Stock

Conjugation Options

ARP30091_P050-FITC Conjugated

ARP30091_P050-HRP Conjugated

ARP30091_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
transcription factor 7-like 1 (T-cell specific, HMG-box)
Protein Name:
Transcription factor 7-like 1
Swissprot Id:
Protein Accession #:
Alias Symbols:
Description of Target:
This gene encodes a member of the T cell factor/lymphoid enhancer factor family of transcription factors. These transcription factors are activated by beta catenin, mediate the Wnt signaling pathway and are antagonized by the transforming growth factor beta signaling pathway. The encoded protein contains a high mobility group-box DNA binding domain and participates in the regulation of cell cycle genes and cellular senescence.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express TF7L1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express TF7L1.
The immunogen is a synthetic peptide directed towards the C-terminal region of Human TF7L1
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Yeast
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Yeast: 100%
Complete computational species homology data:
Anti-TCF7L1 (ARP30091_P050)
Peptide Sequence:
Synthetic peptide located within the following region: LHSQLYPTWSARDNYGKKKKRKREKQLSQTQSQQQVQEAEGALASKSKKP
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
UBC; mdfic; Mdfi; DAZAP2; CTNNB1;
Blocking Peptide:
For anti-TF7L1 (ARP30091_P050) antibody is Catalog # AAP30091
Datasheets / Downloads:
Printable datasheet for anti-TF7L1 (ARP30091_P050) antibody
Ask a Question

Tell us what you think about this item!

Write A Review
    Please, wait...