Now Offering Over 102,157 Antibodies & 44,722 Antigens!

TES-26 Recombinant Protein (Toxocara canis) (OPCA05415)

* Required Fields

$0.00
In Stock
Gene Symbol:
TES-26
Alias Symbols:
Toxocara excretory-secretory antigen 26 Short name: TES-26
Description of Target:
Binds phosphatidylethanolamine.
Swissprot Id:
P54190
Protein Name:
26 kDa secreted antigen
Molecular Weight:
28 kDa
Product Format:
Liquid
Species Reactivity:
Toxocara canis
Formulation:
Tris-base, 50% glycerol
Purity:
Greater than 90% as determined by SDS-PAGE.
Protein Sequence:
Partial: QCMDSASDCAANAGSCFTRPVSQVLQNRCQRTCNTCDCRDEANNCAASINLCQNPTFEPLVRDRCQKTCGLCAGCGFISSGIVPLVVTSAPSRRVSVTFANNVQVNCGNTLTTAQVANQPTVTWEAQPNDRYTLIMVDPDFPSAANGQQGQRLHWWVINIPGNNIAGGTTLAAFQPSTPAANTGVHRYVFLVYRQPAAINSPLLNNLVVQDSERPGFGTTAFATQFNLGSPYAGNFYRSQA
Storage Buffer:
Tris-base, 50% glycerol
Source:
Baculovirus
Additional Information:
Species Specificity Detail: Toxocara canis
Tag:
N-terminal 6xHis-tagged
Reconstitution and Storage:
Store at -20/-80C for 12 months. Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Target Reference:
An abundant, trans-spliced mRNA from Toxocara canis infective larvae encodes a 26-kDa protein with homology to phosphatidylethanolamine-binding proteins.Gems D., Ferguson C.J., Robertson B.D., Nieves R., Page A.P., Blaxter M.L., Maizels R.M.J. Biol. Chem. 270:18517-18522(1995).
Datasheets/Manuals:
Printable datasheet for OPCA05415
Protocol:
Tips Information:

Tell us what you think about this item!

Write A Review
    Please, wait...