Now Offering Over 102,157 Antibodies & 44,722 Antigens!

TBCB antibody - C-terminal region (ARP51934_P050)

100 ul

Regular Price: $289.00

Special Price: $215.00

In Stock

Conjugation Options

ARP51934_P050-FITC Conjugated

ARP51934_P050-HRP Conjugated

ARP51934_P050-Biotin Conjugated

Gene Symbol:
TBCB
NCBI Gene Id:
1155
Official Gene Full Name:
Tubulin folding cofactor B
Protein Name:
Tubulin-folding cofactor B
Swissprot Id:
Q99426
Protein Accession #:
NP_001272
Nucleotide Accession #:
NM_001281
Alias Symbols:
CG22, CKAP1, CKAPI, MGC14625
Replacement Item:
This antibody may replace item sc-366842 from Santa Cruz Biotechnology.
Description of Target:
TBCB binds to alpha-tubulin folding intermediates after their interaction with cytosolic chaperonin in the pathway leading from newly synthesized tubulin to properly folded heterodimer. It is involved in regulation of tubulin heterodimer dissociation. TBCB may function as a negative regulator of axonal growth.
Protein Size (# AA):
244
Molecular Weight:
27kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express TBCB.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express TBCB.
Immunogen:
The immunogen is a synthetic peptide directed towards the C terminal region of human TBCB
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Complete computational species homology data:
Anti-TBCB (ARP51934_P050)
Peptide Sequence:
Synthetic peptide located within the following region: YDEPLGKNDGSVNGKRYFECQAKYGAFVKPAVVTVGDFPEEDYGLDEI
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
SUMO2; UBC; GSS; EIF5; SCPEP1; UBFD1; OGFOD1; STK26; ISOC1; ERP44; MAPRE1; TWF2; PROSC; FERMT2; PDIA4; STK24; YWHAH; YWHAE; VCL; SNRPF; PTMA; PPP1CA; MYO1E; CSE1L; CKB; CAPNS1; ALDH7A1; ASNS; TXNDC5; TPT1; USP7; GAN; ELAVL1; TUBA4A;
Blocking Peptide:
For anti-TBCB (ARP51934_P050) antibody is Catalog # AAP51934 (Previous Catalog # AAPY03590)
Datasheets/Manuals:
Printable datasheet for anti-TBCB (ARP51934_P050) antibody
Sample Type Confirmation:

TBCB is strongly supported by BioGPS gene expression data to be expressed in HEK293T

Target Reference:
Rayala,S.K., (2007) Proc. Natl. Acad. Sci. U.S.A. 104 (49), 19470-19475

Tell us what you think about this item!

Write A Review
    Please, wait...