Now Offering Over 102,157 Antibodies & 44,722 Antigens!

Synuclein-alpha Antibody (Phospho-Tyr136) (OAAF07792)

100 ug
$289.00
In Stock

Conjugation Options

OAAF07792-FITC Conjugated

OAAF07792-HRP Conjugated

OAAF07792-Biotin Conjugated

Gene Symbol:
SNCA
NCBI Gene Id:
6622
Swissprot Id:
P37840
Alias Symbols:
Alpha-synuclein, Non-A beta component of AD amyloid, Non-A4 component of amyloid precursor, NACP, SNCA, NACP, PARK1
Replacement Item:
This antibody may replace item sc-10717 from Santa Cruz Biotechnology.
Molecular Weight:
14 kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
The antibody was purified from rabbit antiserum by affinity-chromatography using phospho peptide. The antibody against non-phospho peptide was removed by chromatography using corresponding non-phospho peptide.
Application:
WB, ELISA
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express SNCA.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express SNCA.
Immunogen:
The antiserum was produced against synthesized peptide derived from human Synuclein-alpha around the phosphorylation site of Tyr136.
Species Reactivity:
Human, Mouse, Rat
Peptide Sequence:
Synthetic peptide located within the following region: ATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA
Reconstitution and Storage:
Stable at -20C for at least 1 year.
Concentration:
1mg/ml
Datasheets/Manuals:
Printable datasheet for OAAF07792
Specificity:
Synuclein-alpha (Phospho-Tyr136) Antibody detects endogenous levels of Synuclein-alpha only when phosphorylated at Tyr136.
Formulation:
Rabbit IgG in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.
Application Info:
WB: 1:500~1:1000
ELISA: 1:5000
Additional Information:
Modification Sites: Human:Y136 Mouse:Y136 Rat:Y136
Protocol:
Tips Information:

Tell us what you think about this item!

Write A Review
    Please, wait...