website statistics

Now Offering Over 102,157 Antibodies & 44,722 Antigens!

STAT3 antibody - N-terminal region (ARP38253_P050)

Scroll Horizontally to view all Images
Print Page
  • Let us Help: Ask a Question
100 ul
$289.00
In Stock

Conjugation Options

ARP38253_P050-FITC Conjugated

ARP38253_P050-HRP Conjugated

ARP38253_P050-Biotin Conjugated

Gene Symbol:
STAT3
NCBI Gene Id:
6774
Official Gene Full Name:
Signal transducer and activator of transcription 3 (acute-phase response factor)
Protein Name:
Signal transducer and activator of transcription 3 isoform 2 EMBL BAG70046.1
Swissprot Id:
B5BTZ6
Protein Accession #:
NP_003141
Nucleotide Accession #:
NM_003150
Alias Symbols:
APRF, FLJ20882, MGC16063, HIES
Replacement Item:
This antibody may replace item sc-126054 from Santa Cruz Biotechnology.
Description of Target:
STAT3 is a member of the STAT protein family. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. STAT3 is activated through phosphorylation in response to various cytokines and growth factors including IFNs, EGF, IL5, IL6, HGF, LIF and BMP2. It mediates the expression of a variety of genes in response to cell stimuli, and thus plays a key role in many cellular processes such as cell growth and apoptosis. The small GTPase Rac1 has been shown to bind and regulate the activity of this protein. PIAS3 protein is a specific inhibitor of this protein.The protein encoded by this gene is a member of the STAT protein family. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. This protein is activated through phosphorylation in response to various cytokines and growth factors including IFNs, EGF, IL5, IL6, HGF, LIF and BMP2. This protein mediates the expression of a variety of genes in response to cell stimuli, and thus plays a key role in many cellular processes such as cell growth and apoptosis. The small GTPase Rac1 has been shown to bind and regulate the activity of this protein. PIAS3 protein is a specific inhibitor of this protein. Three alternatively spliced transcript variants encoding distinct isoforms have been described.
Protein Size (# AA):
769
Molecular Weight:
88kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
IHC, WB, IF
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express STAT3.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express STAT3.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human STAT3
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 79%
Complete computational species homology data:
Anti-STAT3 (ARP38253_P050)
Peptide Sequence:
Synthetic peptide located within the following region: AQWNQLQQLDTRYLEQLHQLYSDSFPMELRQFLAPWIESQDWAYAASKES
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
MTOR; GADD45A; BMX; BLK; UBC; SYK; LMO2; SRI; HIC1; GNB2; USP22; RELA; COPS5; BRD4; ADRB2; PSMG3; TBCD; TBC1D15; PUS7; LUC7L2; ARFIP1; IVNS1ABP; MSH2; BMH1; SIN3A; EGFR; PIAS3; HDAC3; SRC; LYN; JAK3; JAK2; HES5; TRIM28; HES1; HCK; FYN; FGR; HNRNPM; SULT2A
Blocking Peptide:
For anti-STAT3 (ARP38253_P050) antibody is Catalog # AAP38253 (Previous Catalog # AAPP23107)
Datasheets / Downloads:
Printable datasheet for anti-STAT3 (ARP38253_P050) antibody
Additional Information:
IHC Information: Kidney
IHC Information: Uterus
IHC Information: Prostate
Target Reference:
Ohbayashi,N., (2008) Biochem. Biophys. Res. Commun. 371 (4), 823-828
Publications:

Deng, W; Chen, QW; Li, XS; Yuan, ZM; Li, GQ; Ke, DZ; Wang, L; Wu, ZQ; Luo, SL; Bone marrow mesenchymal stromal cells with CD47 high expression via the signal transducer and activators of transcription signaling pathway preventing myocardial fibrosis. 8, 10555-64 (2015). 26617765

Deng, W. et al. Bone marrow mesenchymal stromal cells with support of bispecific antibody and ultrasound-mediated microbubbles prevent myocardial fibrosis via the signal transducer and activators of transcription signaling pathway. Cytotherapy 13, 431-40 (2011). WB, Human, Mouse, Dog, Pig, Bovine, Horse, Rabbit, Rat, Guinea pig, Zebrafish 21174489

Vega, V. L. et al. Activation of the stress response in macrophages alters the M1/M2 balance by enhancing bacterial killing and IL-10 expression. J. Mol. Med. (Berl). (2014). doi:10.1007/s00109-014-1201-y ICC/IF, Human, Mouse, Dog, Pig, Bovine, Horse, Rabbit, Rat, Guinea pig, Zebrafish 25163764

Customer Reviews for STAT3 Antibody (ARP38253_P050) tested with human kidney tissue in Immunohistochemistry

CAT# ARP38253_P050

submitted by:
Vega Virginia
University of California San Diego

"This is one of the pictures that we got using AVIVA antibodies. It shows that after incubation with LPS STAT3 translocates into the nuclei (measured as co-localization with DAPI staining). "

How would you rate this antibody on a scale from 1-5? Why?

5 very good antibodies no background.

How do Aviva's reagents play a role in your experimental goals?

We are working at characterizing how activation of the stress response modifies macrophages activation pathways.

How many different experimental trials were conducted using the antibody sample?

We try these abs in two different macrophages cell lines J774 and RAW264 as well as HEPG2 cells. Experiments were repeated three times in triplicates.

What type of experimental sample are you using and how did you prepare it?

immunostaining of fixed cells (4% PFA permeabilized with cold acetone)

What applications did you test the antibody in? Please include dilutions of the primary and secondary reagents.

Immunostaining using 1:100 dilutions of the primary abs and 1:1000 dilutions for secondaries conjugated with AF488.

What controls were used in your experiment? Please include your positive control.

Positive control: cells were activated with LPS (100ng/ml). Negarive control: naïve macrophages (non-activated cells). Internal control (fixed cell treated only with the secondary ab).

How did you store the antibody after re-suspension?

Aliquots -20C

Please provide the protocol for your application procedure. Please be as detailed as possible.

Cells (0.5 x 106 cells/slide) were fixed with 4% PFA and permeabilized with cold acetone (15 s).

Nonspecific binding was blocked by incubation with 30% human serum, 0.1% BSA, 1% fish gelatin, 5 mM EDTA, and 0.2% Tween 20 in PBS for 0.5 h at 4°C.

Cells were incubated with primary Abs (1/100 dilution) for 1 h at 4°C, extensively washed with 30% FBS and 0.2% Tween 20 in PBS, and incubated with secondary Abs (1/1000 dilution) for 0.5 h at 4°C.

Nuclei were stained with 4',6-diamido-2-phenylindole hydrochloride (DAPI; 15 s, 25°C), and cells were visualized using a fluorescent microscope

Would you use this antibody in future experiments?

yes

If the antibody works, do you plan to use it in future experiments or to publish your data?

Yes

Product Protocols: STAT3 antibody tested with Human Fetal Liver Tissue (ARP38253_P050)

Aviva Systems Biology is the original manufacturer of this STAT3 antibody (ARP38253_P050)

Click here to view the STAT3 antibody Western Blot Protocol

Product Datasheet Link: STAT3 antibody (ARP38253_P050)

WB Suggested Anti-STAT3 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Fetal Liver

Western Blot image:


Description of Target: STAT3 is a member of the STAT protein family. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. STAT3 is activated through phosphorylation in response to various cytokines and growth factors including IFNs, EGF, IL5, IL6, HGF, LIF and BMP2. It mediates the expression of a variety of genes in response to cell stimuli, and thus plays a key role in many cellular processes such as cell growth and apoptosis. The small GTPase Rac1 has been shown to bind and regulate the activity of this protein. PIAS3 protein is a specific inhibitor of this protein.The protein encoded by this gene is a member of the STAT protein family. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. This protein is activated through phosphorylation in response to various cytokines and growth factors including IFNs, EGF, IL5, IL6, HGF, LIF and BMP2. This protein mediates the expression of a variety of genes in response to cell stimuli, and thus plays a key role in many cellular processes such as cell growth and apoptosis. The small GTPase Rac1 has been shown to bind and regulate the activity of this protein. PIAS3 protein is a specific inhibitor of this protein. Three alternatively spliced transcript variants encoding distinct isoforms have been described.

Questions pertaining to this data can be directed to techsupport@avivasysbio.com

Aviva Systems Biology’s STAT3 antibody (ARP38253_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com

 
X
Ask a Question
Average Rating:
1 review
5 star
1
4 star
0
3 star
0
2 star
0
1 star
0
  • Date - Newest First
  • Date - Newest First
  • Date - Latest First
  • Highest Rated
  • Lowest Rated
  • Most Helpful
  • Ownership

1 Item(s)

289/10/2017 16:06
  • Quality:
  • Overall Experience:
Product Review: STAT3 antibody - N-terminal region (ARP38253_P050)
Great product
0
0
Reply
Show more comments (-2) Hide comments

1 Item(s)

What kind of abuse are you reporting?
    Please, wait...