Aviva Systems Biology office will be closed for Thanksgiving Holiday - November 22-23, 2018.
Please go here for more info.

Now Offering Over 102,157 Antibodies & 44,722 Antigens!

Srgap1 antibody - middle region (ARP57446_P050)

100 ul
$289.00
In Stock

Conjugation Options

ARP57446_P050-FITC Conjugated

ARP57446_P050-HRP Conjugated

ARP57446_P050-Biotin Conjugated

Gene Symbol:
Srgap1
NCBI Gene Id:
117600
Official Gene Full Name:
SLIT-ROBO Rho GTPase activating protein 1
Protein Name:
SLIT-ROBO Rho GTPase-activating protein 1
Swissprot Id:
Q91Z69
Protein Accession #:
AAL27030
Nucleotide Accession #:
NM_001081037
Alias Symbols:
Arhgap13, 4930572H05Rik, Srgap1
Replacement Item:
This antibody may replace item sc-153820 from Santa Cruz Biotechnology.
Description of Target:
The function remains unknown.
Protein Size (# AA):
714
Molecular Weight:
80kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express Srgap1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express Srgap1.
Immunogen:
The immunogen is a synthetic peptide corresponding to a region of Mouse
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 79%
Complete computational species homology data:
Anti-Srgap1 (ARP57446_P050)
Peptide Sequence:
Synthetic peptide located within the following region: DAKELDGPVYEKCMAGGDYCDSPYSEHGTLEEVDQDAGTEPHTSEDECRG
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Robo1; Cdc42; Rhoa; BMPR1B;
Blocking Peptide:
For anti-Srgap1 (ARP57446_P050) antibody is Catalog # AAP57446 (Previous Catalog # AAPP41440)
Datasheets/Manuals:
Printable datasheet for anti-Srgap1 (ARP57446_P050) antibody

Tell us what you think about this item!

Write A Review
    Please, wait...