Now Offering Over 102,157 Antibodies & 44,722 Antigens!

SRC antibody - N-terminal region (ARP32475_P050)

100 ul

Regular Price: $289.00

Special Price: $215.00

In Stock

Conjugation Options

ARP32475_P050-FITC Conjugated

ARP32475_P050-HRP Conjugated

ARP32475_P050-Biotin Conjugated

Gene Symbol:
SRC
NCBI Gene Id:
6714
Official Gene Full Name:
V-src sarcoma (Schmidt-Ruppin A-2) viral oncogene homolog (avian)
Protein Name:
Proto-oncogene tyrosine-protein kinase Src
Swissprot Id:
P12931
Protein Accession #:
NP_938033
Nucleotide Accession #:
NM_198291
Alias Symbols:
ASV, SRC1, c-SRC, p60-Src
Replacement Item:
This antibody may replace item sc-130069 from Santa Cruz Biotechnology.
Description of Target:
This gene is highly similar to the v-src gene of Rous sarcoma virus. This proto-oncogene may play a role in the regulation of embryonic development and cell growth. SRC protein is a tyrosine-protein kinase whose activity can be inhibited by phosphorylation by c-SRC kinase. Mutations in this gene could be involved in the malignant progression of colon cancer. This gene is highly similar to the v-src gene of Rous sarcoma virus. This proto-oncogene may play a role in the regulation of embryonic development and cell growth. The protein encoded by this gene is a tyrosine-protein kinase whose activity can be inhibited by phosphorylation by c-SRC kinase. Mutations in this gene could be involved in the malignant progression of colon cancer. Two transcript variants encoding the same protein have been found for this gene.
Protein Size (# AA):
536
Molecular Weight:
60kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express SRC.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express SRC.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human SRC
Species Reactivity:
Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat
Predicted Homology Based on Immunogen Sequence:
Cow: 85%; Dog: 92%; Guinea Pig: 92%; Human: 100%; Mouse: 100%; Rabbit: 77%; Rat: 100%
Complete computational species homology data:
Anti-SRC (ARP32475_P050)
Peptide Sequence:
Synthetic peptide located within the following region: MGSNKSKPKDASQRRRSLEPAENVHGAGGGAFPASQTPSKPASADGHRGP
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
PSMB9; POLR2L; POLR2K; POLR2J; POLR2I; POLR2H; POLR2G; POLR2F; POLR2E; POLR2D; POLR2C; POLR2B; POLR2A; NEDD4; MAPT; ESR1; CA3; ARRB2; UBC; SRC; SPRR2A; IKBKG; CBLC; ZNF658B; TLR4; RGS16; PTGER4; EGFR; ARRB1; TNFRSF1A; KHDRBS1; SYK; CD44; ENO1; ANXA7; PIK3
Blocking Peptide:
For anti-SRC (ARP32475_P050) antibody is Catalog # AAP32475 (Previous Catalog # AAPP03474)
Datasheets/Manuals:
Printable datasheet for anti-SRC (ARP32475_P050) antibody
Target Reference:
Pechkovsky,D.V., (2008) J. Biol. Chem. 283 (19), 12898-12908

Tell us what you think about this item!

Write A Review
    Please, wait...