Now Offering Over 102,157 Antibodies & 44,722 Antigens!

SPINT1 antibody - middle region (ARP44803_P050)

100 ul
$289.00
In Stock

Conjugation Options

ARP44803_P050-FITC Conjugated

ARP44803_P050-HRP Conjugated

ARP44803_P050-Biotin Conjugated

Gene Symbol:
SPINT1
NCBI Gene Id:
6692
Official Gene Full Name:
Serine peptidase inhibitor, Kunitz type 1
Protein Name:
cDNA, FLJ95704, highly similar to Homo sapiens serine protease inhibitor, Kunitz type 1 (SPINT1), mRNA EMBL BAG37346.1
Swissprot Id:
B2RBU9
Protein Accession #:
NP_001027539
Nucleotide Accession #:
NM_001032367
Alias Symbols:
HAI, HAI1, MANSC2
Replacement Item:
This antibody may replace item sc-110417 from Santa Cruz Biotechnology.
Description of Target:
The protein encoded by this gene is a member of the Kunitz family of serine protease inhibitors. The protein is a potent inhibitor specific for HGF activator and is thought to be involved in the regulation of the proteolytic activation of HGF in injured t
Protein Size (# AA):
513
Molecular Weight:
53kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express SPINT1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express SPINT1.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human SPINT1
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data:
Anti-SPINT1 (ARP44803_P050)
Peptide Sequence:
Synthetic peptide located within the following region: PFSEHCARFTYGGCYGNKNNFEEEQQCLESCRGISKKDVFGLRREIPIPS
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
FAM46A; UBQLN4; UBC; ST14; HGFAC;
Blocking Peptide:
For anti-SPINT1 (ARP44803_P050) antibody is Catalog # AAP44803 (Previous Catalog # AAPP12279)
Datasheets/Manuals:
Printable datasheet for anti-SPINT1 (ARP44803_P050) antibody

Tell us what you think about this item!

Write A Review
    Please, wait...