Now Offering Over 102,157 Antibodies & 44,722 Antigens!

SPATA2 Antibody - N-terminal region (ARP59151_P050)

100 ul
$289.00
In Stock

Conjugation Options

ARP59151_P050-FITC Conjugated

ARP59151_P050-HRP Conjugated

ARP59151_P050-Biotin Conjugated

Gene Symbol:
SPATA2
NCBI Gene Id:
9825
Official Gene Full Name:
spermatogenesis associated 2
Protein Name:
spermatogenesis-associated protein 2
Swissprot Id:
Q9UM82
Protein Accession #:
NP_001129245.1
Nucleotide Accession #:
NM_001135773.1
Alias Symbols:
PD1, tamo, PPP1R145
Replacement Item:
This antibody may replace item sc-100946 from Santa Cruz Biotechnology.
Protein Size (# AA):
383
Molecular Weight:
42kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express SPATA2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express SPATA2.
Immunogen:
The immunogen is a synthetic peptide directed towards the N-terminal region of human SPATA2
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data:
Anti-SPATA2 (ARP59151_P050)
Peptide Sequence:
Synthetic peptide located within the following region: SRVALQKSASERAAKDYYKPRVTKPSRSVDAYDSYWESRKPPLKASLSLR
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-SPATA2 (ARP59151_P050) antibody is Catalog # AAP59151
Datasheets/Manuals:
Printable datasheet for anti-SPATA2 (ARP59151_P050) antibody

Tell us what you think about this item!

Write A Review
    Please, wait...