Now Offering Over 102,157 Antibodies & 44,722 Antigens!

SOX10 Antibody - middle region (ARP33326_T100)

  • Catalog#: ARP33326_T100
  • Inquire
Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
$229.00
Discontinued

Conjugation Options

ARP33326_T100-FITC Conjugated

ARP33326_T100-HRP Conjugated

ARP33326_T100-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
SOX10
NCBI Gene Id:
6663
Official Gene Full Name:
SRY (sex determining region Y)-box 10
Protein Name:
Transcription factor SOX-10
Swissprot Id:
P56693
Protein Accession #:
NP_008872
Nucleotide Accession #:
NM_006941
Alias Symbols:
DOM, MGC15649, WS2E, WS4, PCWH, WS4C
Description of Target:
SOX10 is a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. This protein may act as a transcriptional activator after forming a protein complex with other proteins. It acts as a nucleocytoplasmic shuttle protein and is important for neural crest and peripheral nervous system development. Mutations in this gene are associated with Waardenburg-Shah and Waardenburg-Hirschsprung disease.
Protein Size (# AA):
466
Molecular Weight:
50kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Protein A purified
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express SOX10.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express SOX10.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human SOX10
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 86%
Peptide Sequence:
Synthetic peptide located within the following region: RKNGKAAQGEAECPGGEAEQGGTAAIQAHYKSAHLDHRHPGEGSPMSDGN
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
UBC; CDK6; EXOC5; NMI; EPAS1; POU3F2; UTF1; PAX3; UBE2I; OLIG2; HHEX; PAX6; ALX4; PRRX2; SUMO2; POU3F3; SUMO3; SOX10; SUMO1; TCF12; MEOX1; DLX5; HIVEP1; SP1; PRRX1; JUN; POU5F1; HOXC4; HOXA3; EGR2; CEBPA;
Blocking Peptide:
For anti-SOX10 (ARP33326_T100) antibody is Catalog # AAP33326 (Previous Catalog # AAPP04368)
Datasheets/Manuals:
Printable datasheet for anti-SOX10 (ARP33326_T100) antibody
Target Reference:
Collins,J.E., et al., (2004) Genome Biol. 5 (10), R84

Tell us what you think about this item!

Write A Review
    Please, wait...