Aviva Systems Biology office will be closed for Memorial Holiday - May 28th, 2018.
Please go here for more info.

Now Offering Over 102,157 Antibodies & 44,722 Antigens!

SOX10 Antibody - middle region (ARP33326_P050)

Scroll Horizontally to view all Images

 

Print Page
100 ul

Regular Price: $289.00

Special Price: $215.00

In Stock

Conjugation Options

ARP33326_P050-FITC Conjugated

ARP33326_P050-HRP Conjugated

ARP33326_P050-Biotin Conjugated

Gene Symbol:
SOX10
NCBI Gene Id:
6663
Official Gene Full Name:
SRY (sex determining region Y)-box 10
Protein Name:
Transcription factor SOX-10
Swissprot Id:
P56693
Protein Accession #:
NP_008872
Nucleotide Accession #:
NM_006941
Alias Symbols:
DOM, MGC15649, WS2E, WS4, PCWH, WS4C
Replacement Item:
This antibody may replace item sc-17342 from Santa Cruz Biotechnology.
Description of Target:
SOX10 is a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. This protein may act as a transcriptional activator after forming a protein complex with other proteins. It acts as a nucleocytoplasmic shuttle protein and is important for neural crest and peripheral nervous system development. Mutations in this gene are associated with Waardenburg-Shah and Waardenburg-Hirschsprung disease.
Protein Size (# AA):
466
Molecular Weight:
50kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express SOX10.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express SOX10.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human SOX10
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 86%
Complete computational species homology data:
Anti-SOX10 (ARP33326_P050)
Peptide Sequence:
Synthetic peptide located within the following region: PGGEAEQGGTAAIQAHYKSAHLDHRHPGEGSPMSDGNPEHPSGQSHGPPT
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
UBC; CDK6; EXOC5; NMI; EPAS1; POU3F2; UTF1; PAX3; UBE2I; OLIG2; HHEX; PAX6; ALX4; PRRX2; SUMO2; POU3F3; SUMO3; SOX10; SUMO1; TCF12; MEOX1; DLX5; HIVEP1; SP1; PRRX1; JUN; POU5F1; HOXC4; HOXA3; EGR2; CEBPA;
Blocking Peptide:
For anti-SOX10 (ARP33326_P050) antibody is Catalog # AAP33326
Datasheets/Manuals:
Printable datasheet for anti-SOX10 (ARP33326_P050) antibody
Publications:

Wilson, NR; Olm-Shipman, AJ; Acevedo, DS; Palaniyandi, K; Hall, EG; Kosa, E; Stumpff, KM; Smith, GJ; Pitstick, L; Liao, EC; Bjork, BC; Czirok, A; Saadi, I; SPECC1L deficiency results in increased adherens junction stability and reduced cranial neural crest cell delamination. 6, 17735 (2016). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 26787558

Additional Product Images:

Customer Reviews for SOX10 Antibody (ARP33326_P050) tested with HEK293 in Western Blot

CAT# ARP33326

submitted by:
Sergey Ivanov
Vanderbilt University

What type of experimental sample are you using and how did you prepare it?

We are using HEK293 whole cell lysates with Aviva protocol.

What applications did you test the antibody in? Please include dilutions of the primary and secondary reagents.

The primary antibodies were tested in Western blot experiments at 1:4,000, secondary antibody was used at 1:10,000 dilution.

What controls were used in your experiment? Please include your positive control.

p53 is used as a positive control; protein transfer was monitored via Ponceau staining.

How did you store the antibody after re-suspension?

Frozen at -20 C in aliquots.

Please provide the protocol for your application procedure. Please be as detailed as possible.

Experiment done using the Aviva protocol. All antibodies show virtually no background.

How would you rate this antibody on a scale from 1-5? Why?

excellent (5, produced unique bands with expected sizes)

Would you use this antibody in future experiments?

yes

Product Protocols: SOX10 antibody tested with Human Hepg2 Cells (ARP33326_P050)

Aviva Systems Biology is the original manufacturer of this SOX10 antibody (ARP33326_P050)

Click here to view the SOX10 antibody Western Blot Protocol

Product Datasheet Link: SOX10 antibody (ARP33326_P050)

WB Suggested Anti-SOX10 Antibody Titration: .25ug/ml
ELISA Titer: 1:62500
Positive Control: HepG2

Western Blot image:


Description of Target: SOX10 is a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. This protein may act as a transcriptional activator after forming a protein complex with other proteins. It acts as a nucleocytoplasmic shuttle protein and is important for neural crest and peripheral nervous system development. Mutations in this gene are associated with Waardenburg-Shah and Waardenburg-Hirschsprung disease.

Questions pertaining to this data can be directed to techsupport@avivasysbio.com

Aviva Systems Biology’s SOX10 antibody (ARP33326_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com

Product Protocols: SOX10 antibody tested by IHC with human skin (ARP33326)

Aviva Systems Biology is the original manufacturer of this SOX10 antibody.

Click here to view the SOX10 antibody Immunohistochemistry (IHC) protocol

Product Datasheet Link: SOX10 antibody (ARP33326)

IHC Information:

Rabbit Anti-SOX10 Antibody
Catalog Number: ARP33326
Paraffin Embedded Tissue: Human Skin
Cellular Data: Epidermal cells
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X

IHC Image:

Product Protocols: SOX10 antibody tested by IHC with human kidney (ARP33326)

Aviva Systems Biology is the original manufacturer of this SOX10 antibody.

Click here to view the SOX10 antibody Immunohistochemistry (IHC) protocol

Product Datasheet Link: SOX10 antibody (ARP33326)

IHC Information:

Rabbit Anti-SOX10 Antibody
Catalog Number: ARP33326
Paraffin Embedded Tissue: Human Kidney
Cellular Data: Epithelial cells of renal tubule
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X

IHC Image:

Product Review: SOX10 antibody – middle region (ARP33326_P050) in human optic nerves and spinal cord using Immunohistochemistry

Product Page Link: SOX10 antibody - middle region (ARP33326_P050)

Alison Jennings
UWA
School of Pathology and Laboratory Medicine M504

  • Lyophilized antibody samples reconstituted in 10ul distilled water.
  • Antibody dilutions made up in PBS.
  • Microwave Antigen retrieval of sections carried out in 0.5% citraconic anhydride (Sigma) pH7.4 for 25 minutes at 92C followed by cooling to ambient temperature (approx. 20 minutes).
  • Blocking step 10% normal horse serum in PBS.
  • Primary antibody incubation for 2 hours at 37C then overnight at 4C.
  • Blocking of non specific peroxidase with 3% hydrogen peroxide for 5 minutes.
  • Secondary link antibody either PolyEnvision (pEV; Dako) or Novolink (NL; Novocastra).
  • Chromogen DAB (Vector ImmPACT).

Tissue sections

A/ [IHC-PZ] (optimal processing)
human optic nerve (short post mortem interval) fixed by immersion in zinc-based fixative (BD Pharmingen 552658), processed to minimize antigen loss (shortened protocol, reduced exposure to high temperature); embedded in paraffin wax; sectioned at 3 microns

A2/ [IHC-PZ + FF]
As above for initial fixation then post-fixed in 10% buffered formalin for 5 days

B/ [IHC-P]
human optic nerve and spinal cord fixed in 10% buffered formalin (relatively short post mortem interval and fixation duration); standard processing; embedded in paraffin wax; sectioned at 3 microns

Controls
Negative: omission of primary.
Positive: Olig2 reactivity was in comparison with antibody from Prof Charles Stiles/ Dr John Alberta (DF308; N terminal Olig2) used at 1:10000 (IHC-PZ); 1:4000 (IHC-P)

 
X
Ask a Question
Average Rating:
1 review
5 star
1
4 star
0
3 star
0
2 star
0
1 star
0
  • Date - Newest First
  • Date - Newest First
  • Date - Latest First
  • Highest Rated
  • Lowest Rated
  • Most Helpful
  • Ownership

1 Item(s)

43/02/2018 00:18
  • Overall Experience:
  • Quality:
Western Blot with HEK293

submitted by:
Sergey Ivanov
Vanderbilt University

What type of experimental sample are you using and how did you prepare it?

We are using HEK293 whole cell lysates with Aviva protocol.

What applications did you test the antibody in? Please include dilutions of the primary and secondary reagents.

The primary antibodies were tested in Western blot experiments at 1:4,000, secondary antibody was used at 1:10,000 dilution.

What controls were used in your experiment? Please include your positive control.

p53 is used as a positive control; protein transfer was monitored via Ponceau staining.

How did you store the antibody after re-suspension?

Frozen at -20 C in aliquots.

Please provide the protocol for your application procedure. Please be as detailed as possible.

Experiment done using the Aviva protocol. All antibodies show virtually no background.

How would you rate this antibody on a scale from 1-5? Why?

excellent (5, produced unique bands with expected sizes)

Would you use this antibody in future experiments?

yes

0
0
Reply
Show more comments (-2) Hide comments

1 Item(s)

What kind of abuse are you reporting?
    Please, wait...