Aviva Systems Biology office will be closed for Independence Day - July 4th, 2018.
Please go here for more info.

Now Offering Over 102,157 Antibodies & 44,722 Antigens!

SOD1 Recombinant Protein (Brachydanio rerio) (OPCA05078)

Print Page
10ug
    $255.00
    In Stock
    Gene Symbol:
    SOD1
    Official Gene Full Name:
    superoxide dismutase 1, soluble
    NCBI Gene Id:
    30553
    Alias Symbols:
    Cu/Zn-SOD, cuzn, ZSOD
    Description of Target:
    Destroys radicals which are normally produced within the cells and which are toxic to biological systems.
    Swissprot Id:
    O73872
    Protein Accession #:
    NP_571369
    Nucleotide Accession #:
    NM_131294
    Protein Name:
    Superoxide dismutase [Cu-Zn]
    Molecular Weight:
    37 kDa
    Tissue Tool:
    Find tissues and cell lines supported by DNA array analysis to express SOD1.
    RNA Seq:
    Find tissues and cell lines supported by RNA-seq analysis to express SOD1.
    Product Format:
    Liquid
    Species Reactivity:
    Brachydanio rerio
    Formulation:
    Tris-base, 50% glycerol
    Purity:
    Greater than 90% as determined by SDS-PAGE.
    Protein Sequence:
    Full Length : MVNKAVCVLKGTGEVTGTVYFNQEGEKKPVKVTGEITGLTPGKHGFHVHAFGDNTNGCISAGPHFNPHDKTHGGPTDSVRHVGDLGNVTADASGVAKIEIEDAMLTLSGQHSIIGRTMVIHEKEDDLGKGGNEESLKTGNAGGRLACGVIGITQ
    Storage Buffer:
    Tris-base, 50% glycerol
    Source:
    E.coli
    Additional Information:
    Species Specificity Detail: Danio rerio (Zebrafish) (Brachydanio rerio)
    Tag:
    N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
    Reconstitution and Storage:
    Store at -20/-80C for 12 months. Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
    Target Reference:
    Comparative effects of dietary methylmercury on gene expression in liver, skeletal muscle, and brain of the zebrafish (Danio rerio).
    Gonzalez P., Dominique Y., Massabuau J.C., Boudou A., Bourdineaud J.P.
    Environ. Sci. Technol. 39:3972-3980(2005)
    Datasheets/Manuals:
    Printable datasheet for OPCA05078
    Protocol:
    Tips Information:
     
    X
    Ask a Question

    Tell us what you think about this item!

    Write A Review
      Please, wait...