Now Offering Over 102,157 Antibodies & 44,722 Antigens!

SOD1 Recombinant Protein (Brachydanio rerio) (OPCA05078)

* Required Fields

$0.00
In Stock
Gene Symbol:
SOD1
Official Gene Full Name:
superoxide dismutase 1, soluble
NCBI Gene Id:
30553
Alias Symbols:
Cu/Zn-SOD, cuzn, ZSOD
Description of Target:
Destroys radicals which are normally produced within the cells and which are toxic to biological systems.
Swissprot Id:
O73872
Protein Accession #:
NP_571369
Nucleotide Accession #:
NM_131294
Protein Name:
Superoxide dismutase [Cu-Zn]
Molecular Weight:
37 kDa
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express SOD1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express SOD1.
Product Format:
Liquid
Species Reactivity:
Brachydanio rerio
Formulation:
Tris-base, 50% glycerol
Purity:
Greater than 90% as determined by SDS-PAGE.
Protein Sequence:
Full Length : MVNKAVCVLKGTGEVTGTVYFNQEGEKKPVKVTGEITGLTPGKHGFHVHAFGDNTNGCISAGPHFNPHDKTHGGPTDSVRHVGDLGNVTADASGVAKIEIEDAMLTLSGQHSIIGRTMVIHEKEDDLGKGGNEESLKTGNAGGRLACGVIGITQ
Storage Buffer:
Tris-base, 50% glycerol
Source:
E.coli
Additional Information:
Species Specificity Detail: Danio rerio (Zebrafish) (Brachydanio rerio)
Tag:
N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
Reconstitution and Storage:
Store at -20/-80C for 12 months. Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Target Reference:
Comparative effects of dietary methylmercury on gene expression in liver, skeletal muscle, and brain of the zebrafish (Danio rerio).
Gonzalez P., Dominique Y., Massabuau J.C., Boudou A., Bourdineaud J.P.
Environ. Sci. Technol. 39:3972-3980(2005)
Datasheets/Manuals:
Printable datasheet for OPCA05078
Protocol:
Tips Information:

Tell us what you think about this item!

Write A Review
    Please, wait...