Now Offering Over 102,157 Antibodies & 44,722 Antigens!

SNCA antibody - middle region (ARP42350_P050)

100 ul
$289.00
In Stock

Conjugation Options

ARP42350_P050-FITC Conjugated

ARP42350_P050-HRP Conjugated

ARP42350_P050-Biotin Conjugated

Gene Symbol:
SNCA
NCBI Gene Id:
6622
Official Gene Full Name:
Synuclein, alpha (non A4 component of amyloid precursor)
Protein Name:
Alpha-synuclein
Swissprot Id:
P37840-2
Protein Accession #:
NP_009292
Nucleotide Accession #:
NM_007308
Alias Symbols:
MGC110988, NACP, PARK1, PARK4, PD1
Replacement Item:
This antibody may replace item sc-10717 from Santa Cruz Biotechnology.
Description of Target:
Alpha-synuclein is a member of the synuclein family, which also includes beta- and gamma-synuclein. Synucleins are abundantly expressed in the brain and alpha- and beta-synuclein inhibit phospholipase D2 selectively. SNCA may serve to integrate presynaptic signaling and membrane trafficking. Defects in SNCA have been implicated in the pathogenesis of Parkinson disease. SNCA peptides are a major component of amyloid plaques in the brains of patients with Alzheimer's disease.Alpha-synuclein is a member of the synuclein family, which also includes beta- and gamma-synuclein. Synucleins are abundantly expressed in the brain and alpha- and beta-synuclein inhibit phospholipase D2 selectively. SNCA may serve to integrate presynaptic signaling and membrane trafficking. Defects in SNCA have been implicated in the pathogenesis of Parkinson disease. SNCA peptides are a major component of amyloid plaques in the brains of patients with Alzheimer's disease. Two alternatively spliced transcripts of SNCA have been identified. Additional splicing may be present but the full-length nature of these variants has not been determined.
Protein Size (# AA):
112
Molecular Weight:
11kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express SNCA.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express SNCA.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human SNCA
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%
Complete computational species homology data:
Anti-SNCA (ARP42350_P050)
Peptide Sequence:
Synthetic peptide located within the following region: VTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKEGYQDYEPEA
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
NEDD4L; UBC; NEDD4; SNCA; GAPDH; HPRT1; CHMP5; KLK6; PARK7; LAMP2; CDC5; SLG1; PLK2; SAC7; TUS1; ROM2; MID2; Csnk2b; Lyn; Fgr; Csnk1g3; Syk; Rab5a; YWHAQ; ARPP19; RABAC1; TUBA1B; CALM; ACTA1; HIST2H3C; TUBB1; BDH2; USP47; SAP30BP; PELP1; SIN3A; Rab3a; ENC
Blocking Peptide:
For anti-SNCA (ARP42350_P050) antibody is Catalog # AAP42350 (Previous Catalog # AAPP24705)
Datasheets/Manuals:
Printable datasheet for anti-SNCA (ARP42350_P050) antibody
Target Reference:
Wu,K.P., (2008) J. Mol. Biol. 378 (5), 1104-1115

Tell us what you think about this item!

Write A Review
    Please, wait...