Aviva Systems Biology office will be closed for Memorial Holiday - May 28th, 2018.
Please go here for more info.

Now Offering Over 102,157 Antibodies & 44,722 Antigens!

SMAD3 antibody - N-terminal region (P100621_T100)

Scroll Horizontally to view all Images

 

Print Page
100 ul
$229.00
In Stock

Conjugation Options

P100621_T100-FITC Conjugated

P100621_T100-HRP Conjugated

P100621_T100-Biotin Conjugated

Gene Symbol:
SMAD3
NCBI Gene Id:
4088
Official Gene Full Name:
SMAD family member 3
Swissprot Id:
Q92940
Protein Accession #:
NP_005893
Nucleotide Accession #:
NM_005902
Alias Symbols:
LDS1C, MADH3, JV15-2, HSPC193, HsT17436
Replacement Item:
This antibody may replace item sc-101154 from Santa Cruz Biotechnology.
Description of Target:
SMAD3 is a member of Smad family proteins. SMAD family is known to be important cytoplasmic mediators of signals from the transforming growth factor-beta (TGF-beta) receptor serine/threonine kinases.
Protein Size (# AA):
425
Molecular Weight:
48kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Protein A purified
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express SMAD3.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express SMAD3.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human SMAD3
Species Reactivity:
Dog, Guinea Pig, Human, Mouse, Rat, Zebrafish
Predicted Homology Based on Immunogen Sequence:
Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 100%
Complete computational species homology data:
Anti-SMAD3 (P100621_T100)
Peptide Sequence:
Synthetic peptide located within the following region: FTPPIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDELEKAIT
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
TEKT4; CCDC33; CPSF7; MEOX2; HDAC1; PHC2; WWP1; AES; BLZF1; UBC; TP53; SMAD4; BACH1; MAFK; FOXO3; NEDD8; TRIM33; WWP2; SMURF2; FOXM1; TRIM62; TP63; OTUB1; NEDD4L; BAG3; TGFB1I1; CSNK1D; RUNX1; HCVgp1; TSC2; FHL3; FHL2; FHL1; Melk; IRF7; RNF111; LCK; KLF5;
Blocking Peptide:
For anti-SMAD3 (P100621_T100) antibody is Catalog # AAP30955 (Previous Catalog # AAPP01679)
Datasheets/Manuals:
Printable datasheet for anti-SMAD3 (P100621_T100) antibody
Target Reference:
Cheng,P.L., et al., (2004) Oncogene 23 (47), 7821-7838

Product Protocols: SMAD3 antibody tested with Human Liver Tissue (P100621_T100)

Aviva Systems Biology is the original manufacturer of this SMAD3 antibody (P100621_T100)

Click here to view the SMAD3 antibody Western Blot Protocol

Product Datasheet Link: SMAD3 antibody (P100621_T100)

WB Suggested Anti-SMAD3 Antibody Titration: 2.0ug/ml
Positive Control: Liver

Western Blot image:


Description of Target: SMAD3 is a member of Smad family proteins. SMAD family is known to be important cytoplasmic mediators of signals from the transforming growth factor-beta (TGF-beta) receptor serine/threonine kinases.

Questions pertaining to this data can be directed to techsupport@avivasysbio.com

Aviva Systems Biology’s SMAD3 antibody (P100621_T100) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com

Product Protocols: SMAD3 antibody tested by IHC with human pancreas (P100621)

Aviva Systems Biology is the original manufacturer of this SMAD3 antibody.

Click here to view the SMAD3 antibody Immunohistochemistry (IHC) protocol

Product Datasheet Link: SMAD3 antibody (P100621)

IHC Information:

Rabbit Anti-SMAD3 Antibody
Catalog Number: P100621
Paraffin Embedded Tissue: Human Pancreas
Cellular Data: Epithelial cells
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X

IHC Image:

Product Protocol: SMAD3 Antibody (P100621_T100) in Human Urinary Bladder Tissue using Immunohistochemistry

Aviva Systems Biology is the original manufacturer of this SMAD3 antibody.
Product Datasheet Link: SMAD3 antibody P100621_T100

Rabbit Anti-SMAD3 Antibody
Catalog Number: P100621_T100
Formalin Fixed Paraffin Embedded Tissue: Human Urinary Bladder Tissue
Observed Staining: Cytoplasm
Primary Antibody Concentration: 1:100
Other Working Concentrations: N/A
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20X
Exposure Time: 0.5 - 2.0 sec

Left to right:
DAPI, SMAD3 Ab, Merge

Control Image:
Control Antibody: Normal Rabbit IgG
Control Antibody Concentration: 1:100

Left to right:
DAPI, Rabbit IgG, Merge

Protocol:
1. Normal adult human urinary bladder tissue was formalin fixed, embedded in paraffin wax, sectioned at 6 micron thickness and put on histological slides.
2. After deparaffinization and rehydration, the low pH, heat-induced antigen retrieval method utilizing Sodium Citrate buffer was performed.
3. The blocking buffer was 5% normal goat serum.
4. Primary antibodies was diluted in antibody dilution buffer (1% Normal Donkey Serum) to the final testing dilution (1:100, 1:600, 1:1200).
5. The appropriate anti-rabbit fluorescent-conjugated (Rhodamine:red or FITC:green) secondary antibody was applied and nuclei will be counterstained with DAPI (blue).
6. A Negative control utilized a nonspecific rabbit IgG staining the same normal adult human urinary bladder tissue.

 
X
Ask a Question

Tell us what you think about this item!

Write A Review
    Please, wait...