Now Offering Over 102,157 Antibodies & 44,722 Antigens!

SLIT1 antibody - middle region : FITC (ARP58765_P050-FITC)

100 ul
$289.00
In Stock

Conjugation Options

ARP58765_P050 Unconjugated

ARP58765_P050-HRP Conjugated

ARP58765_P050-Biotin Conjugated

Gene Symbol:
SLIT1
NCBI Gene Id:
6585
Official Gene Full Name:
Slit homolog 1 (Drosophila)
Protein Name:
Slit homolog 1 protein
Swissprot Id:
O75093
Protein Accession #:
NP_003052
Nucleotide Accession #:
NM_003061
Alias Symbols:
MEGF4, SLIL1, SLIT3, Slit-1, SLIT-1
Replacement Item:
This antibody may replace item sc-16616 from Santa Cruz Biotechnology.
Description of Target:
SLIT1 is thought to act as molecular guidance cue in cellular migration, and function appears to be mediated by interaction with roundabout homolog receptors. During neural development involved in axonal navigation at the ventral midline of the neural tub
Protein Size (# AA):
1534
Molecular Weight:
168kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express SLIT1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express SLIT1.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human SLIT1
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 100%; Rat: 93%; Zebrafish: 86%
Complete computational species homology data:
Anti-SLIT1 (ARP58765_P050)
Peptide Sequence:
Synthetic peptide located within the following region: GAHCVCDPGFSGELCEQESECRGDPVRDFHQVQRGYAICQTTRPLSWVEC
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Concentration:
1 mg/ml
Protein Interactions:
ATN1; ROBO1; GPC1;
Blocking Peptide:
For anti-SLIT1 (ARP58765_P050-FITC) antibody is Catalog # AAP58765 (Previous Catalog # AAPP38532)
Datasheets/Manuals:
Printable datasheet for anti-SLIT1 (ARP58765_P050-FITC) antibody
Conjugation:
FITC (FAM): Excitation 495 nm/ Emission 520 nm
Target Reference:
Hussain,S.A., (2006) J. Biol. Chem. 281 (51), 39693-39698

Tell us what you think about this item!

Write A Review
    Please, wait...