Now Offering Over 102,157 Antibodies & 44,722 Antigens!

SLC8A3 antibody - N-terminal region (ARP44074_P050)

100 ul

Regular Price: $289.00

Special Price: $215.00

In Stock

Conjugation Options

ARP44074_P050-FITC Conjugated

ARP44074_P050-HRP Conjugated

ARP44074_P050-Biotin Conjugated

Gene Symbol:
SLC8A3
NCBI Gene Id:
6547
Official Gene Full Name:
Solute carrier family 8 (sodium/calcium exchanger), member 3
Protein Name:
Sodium/calcium exchanger 3
Swissprot Id:
Q96QG2
Protein Accession #:
NP_150287
Nucleotide Accession #:
NM_033262
Alias Symbols:
NCX3
Replacement Item:
This antibody may replace item sc-30306 from Santa Cruz Biotechnology.
Description of Target:
SLC8A3 is a member of the sodium/calcium exchanger integral membrane protein family. Three mammalian isoforms in family 8 have been identified. Na+/Ca2+ exchange proteins are involved in maintaining Ca2+ homeostasis in a wide variety of cell types. The protein is regulated by intracellular calcium ions and is found in both the plasma membrane and intracellular organellar membranes, where exchange of Na+ for Ca2+ occurs in an electrogenic manner.This gene encodes a member of the sodium/calcium exchanger integral membrane protein family. Three mammalian isoforms in family 8 have been identified. Na+/Ca2+ exchange proteins are involved in maintaining Ca2+ homeostasis in a wide variety of cell types. The protein is regulated by intracellular calcium ions and is found in both the plasma membrane and intracellular organellar membranes, where exchange of Na+ for Ca2+ occurs in an electrogenic manner. Alternative splicing has been observed for this gene and multiple variants have been described.
Protein Size (# AA):
925
Molecular Weight:
103kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express SLC8A3.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express SLC8A3.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human SLC8A3
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data:
Anti-SLC8A3 (ARP44074_P050)
Peptide Sequence:
Synthetic peptide located within the following region: SAPEILLSLIEVCGHGFIAGDLGPSTIVGSAAFNMFIIIGICVYVIPDGE
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
YWHAE; YWHAB; YWHAQ; PPP3CB;
Blocking Peptide:
For anti-SLC8A3 (ARP44074_P050) antibody is Catalog # AAP44074 (Previous Catalog # AAPP25520)
Datasheets/Manuals:
Printable datasheet for anti-SLC8A3 (ARP44074_P050) antibody
Target Reference:
Pulina,M.V., (2006) J. Biol. Chem. 281 (28), 19645-19654
Publications:

Heise, N. et al. Effect of dexamethasone on Na+/Ca2+ exchanger in dendritic cells. Am. J. Physiol. Cell Physiol. 300, C1306-13 (2011). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 21307349

Tell us what you think about this item!

Write A Review
    Please, wait...