Now Offering Over 102,157 Antibodies & 44,722 Antigens!

SLC6A1 antibody - middle region (ARP43834_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
Print Page
100 ul

Regular Price: $289.00

Special Price: $215.00

In Stock

Conjugation Options

ARP43834_P050-FITC Conjugated

ARP43834_P050-HRP Conjugated

ARP43834_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
Solute carrier family 6 (neurotransmitter transporter, GABA), member 1
Protein Name:
Sodium- and chloride-dependent GABA transporter 1
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Description of Target:
SLC6A1 terminates the action of GABA by its high affinity sodium-dependent reuptake into presynaptic terminals. This protein is the target of psychomotor stimulants such as amphetamines or cocaine.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express SLC6A1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express SLC6A1.
The immunogen is a synthetic peptide directed towards the middle region of human SLC6A1
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 86%; Rat: 100%; Zebrafish: 93%
Complete computational species homology data:
Anti-SLC6A1 (ARP43834_P050)
Peptide Sequence:
Synthetic peptide located within the following region: CCINSCTSMFAGFVIFSIVGFMAHVTKRSIADVAASGPGLAFLAYPEAVT
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Htt; STX1A;
Blocking Peptide:
For anti-SLC6A1 (ARP43834_P050) antibody is Catalog # AAP43834 (Previous Catalog # AAPP26614)
Printable datasheet for anti-SLC6A1 (ARP43834_P050) antibody
Target Reference:
Gotlib,I.H., (2008) Biol. Psychiatry 63 (9), 847-851
Ask a Question

Tell us what you think about this item!

Write A Review
    Please, wait...