Now Offering Over 102,157 Antibodies & 44,722 Antigens!

SLC2A5 Antibody (ARP42096_P050)

100 ul

Regular Price: $289.00

Special Price: $215.00

In Stock

Conjugation Options

ARP42096_P050-FITC Conjugated

ARP42096_P050-HRP Conjugated

ARP42096_P050-Biotin Conjugated

Gene Symbol:
SLC2A5
NCBI Gene Id:
6518
Official Gene Full Name:
Solute carrier family 2 (facilitated glucose/fructose transporter), member 5
Protein Name:
Solute carrier family 2, facilitated glucose transporter member 5
Swissprot Id:
P22732
Protein Accession #:
NP_003030
Nucleotide Accession #:
NM_003039
Alias Symbols:
GLUT5, GLUT-5
Replacement Item:
This antibody may replace item sc-14841 from Santa Cruz Biotechnology.
Description of Target:
SLC2A5 is a cytochalasin B-sensitive carrier. It seems to function primarily as a fructose transporter.
Protein Size (# AA):
501
Molecular Weight:
55kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
IF, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express SLC2A5.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express SLC2A5.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human SLC2A5
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Sheep
Predicted Homology Based on Immunogen Sequence:
Cow: 85%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Sheep: 85%
Complete computational species homology data:
Anti-SLC2A5 (ARP42096_P050)
Peptide Sequence:
Synthetic peptide located within the following region: ADQIYLSAGVPEEHVQYVTAGTGAVNVVMTFCAVFVVELLGRRLLLLLGF
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
CCL5; RPSA;
Blocking Peptide:
For anti-SLC2A5 (ARP42096_P050) antibody is Catalog # AAP42096 (Previous Catalog # AAPP24575)
Datasheets/Manuals:
Printable datasheet for anti-SLC2A5 (ARP42096_P050) antibody
Target Reference:
Fu,Y., (2004) Blood Cells Mol. Dis. 32 (1), 182-190

Tell us what you think about this item!

Write A Review
    Please, wait...