Now Offering Over 102,157 Antibodies & 44,722 Antigens!

SLC18A2 antibody - N-terminal region (ARP43845_P050)

100 ul

Regular Price: $289.00

Special Price: $215.00

In Stock

Conjugation Options

ARP43845_P050-FITC Conjugated

ARP43845_P050-HRP Conjugated

ARP43845_P050-Biotin Conjugated

Gene Symbol:
SLC18A2
NCBI Gene Id:
6571
Official Gene Full Name:
Solute carrier family 18 (vesicular monoamine), member 2
Protein Name:
Synaptic vesicular amine transporter
Swissprot Id:
Q05940
Protein Accession #:
NP_003045
Nucleotide Accession #:
NM_003054
Alias Symbols:
MGC120477, MGC120478, MGC26538, SVAT, SVMT, VAT2, VMAT2
Replacement Item:
This antibody may replace item sc-15314 from Santa Cruz Biotechnology.
Description of Target:
The vesicular monoamine transporter acts to accumulate cytosolic monoamines into synaptic vesicles, using the proton gradient maintained across the synaptic vesicular membrane. Its proper function is essential to the correct activity of the monoaminergic systems that have been implicated in several human neuropsychiatric disorders. The transporter is a site of action of important drugs, including reserpine and tetrabenazine.
Protein Size (# AA):
514
Molecular Weight:
56kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express SLC18A2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express SLC18A2.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human SLC18A2
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 86%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 93%; Rabbit: 100%; Rat: 100%
Complete computational species homology data:
Anti-SLC18A2 (ARP43845_P050)
Peptide Sequence:
Synthetic peptide located within the following region: NATRDLTLHQTATQHMVTNASAVPSDCPSEDKDLLNENVQVGLLFASKAT
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
PARK7; UBC; CSNK1A1; CSNK2A2; CSNK2A1;
Blocking Peptide:
For anti-SLC18A2 (ARP43845_P050) antibody is Catalog # AAP43845 (Previous Catalog # AAPS14306)
Datasheets/Manuals:
Printable datasheet for anti-SLC18A2 (ARP43845_P050) antibody
Target Reference:
Yamamoto,S., (2006) Neurosci. Lett. 396 (3), 187-191

Tell us what you think about this item!

Write A Review
    Please, wait...