Now Offering Over 102,157 Antibodies & 44,722 Antigens!

SLC18A1 antibody - middle region (ARP35649_P050)

100 ul

Regular Price: $289.00

Special Price: $215.00

In Stock

Conjugation Options

ARP35649_P050-FITC Conjugated

ARP35649_P050-HRP Conjugated

ARP35649_P050-Biotin Conjugated

Gene Symbol:
SLC18A1
NCBI Gene Id:
6570
Official Gene Full Name:
Solute carrier family 18 (vesicular monoamine), member 1
Protein Name:
Chromaffin granule amine transporter
Swissprot Id:
P54219
Protein Accession #:
NP_003044
Nucleotide Accession #:
NM_003053
Alias Symbols:
CGAT, VAT1, VMAT1
Replacement Item:
This antibody may replace item sc-166391 from Santa Cruz Biotechnology.
Description of Target:
The vesicular monoamine transporter acts to accumulate cytosolic monoamines into vesicles, using the proton gradient maintained across the vesicular membrane. Its proper function is essential to the correct activity of the monoaminergic systems that have been implicated in several human neuropsychiatric disorders. The transporter is a site of action of important drugs, including reserpine and tetrabenazineThe vesicular monoamine transporter acts to accumulate cytosolic monoamines into vesicles, using the proton gradient maintained across the vesicular membrane. Its proper function is essential to the correct activity of the monoaminergic systems that have been implicated in several human neuropsychiatric disorders. The transporter is a site of action of important drugs, including reserpine and tetrabenazine (Peter et al., 1993 [PubMed 7905859]). See also SLC18A2 (MIM 193001).[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Protein Size (# AA):
525
Molecular Weight:
56kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express SLC18A1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express SLC18A1.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human SLC18A1
Species Reactivity:
Cow, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Predicted Homology Based on Immunogen Sequence:
Cow: 79%; Guinea Pig: 86%; Horse: 92%; Human: 100%; Mouse: 85%; Rabbit: 91%; Rat: 86%
Complete computational species homology data:
Anti-SLC18A1 (ARP35649_P050)
Peptide Sequence:
Synthetic peptide located within the following region: YYLRSPPAKEEKLAILSQDCPMETRMYATQKPTKEFPLGEDSDEEPDHEE
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-SLC18A1 (ARP35649_P050) antibody is Catalog # AAP35649 (Previous Catalog # AAPP07896)
Datasheets/Manuals:
Printable datasheet for anti-SLC18A1 (ARP35649_P050) antibody
Target Reference:
Lohoff,F.W., (er) Neuropsychobiology 57 (1-2), 55-60 (2008) In press

Tell us what you think about this item!

Write A Review
    Please, wait...