Now Offering Over 102,157 Antibodies & 44,722 Antigens!

SIM1 antibody - N-terminal region (ARP38549_P050)

Print Page
100 ul

Regular Price: $289.00

Special Price: $215.00

In Stock

Conjugation Options

ARP38549_P050-FITC Conjugated

ARP38549_P050-HRP Conjugated

ARP38549_P050-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
Single-minded homolog 1 (Drosophila)
Protein Name:
Single-minded homolog 1
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-8713 from Santa Cruz Biotechnology.
Description of Target:
SIM1 and SIM2 genes are Drosophila single-minded (sim) gene homologs. SIM1 transcript was detected only in fetal kidney out of various adult and fetal tissues tested. Since the sim gene plays an important role in Drosophila development and has peak leve
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express SIM1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express SIM1.
The immunogen is a synthetic peptide directed towards the N terminal region of human SIM1
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Complete computational species homology data:
Anti-SIM1 (ARP38549_P050)
Peptide Sequence:
Synthetic peptide located within the following region: MKEKSKNAARTRREKENSEFYELAKLLPLPSAITSQLDKASIIRLTTSYL
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-SIM1 (ARP38549_P050) antibody is Catalog # AAP38549 (Previous Catalog # AAPP20740)
Printable datasheet for anti-SIM1 (ARP38549_P050) antibody
Target Reference:
Hung,C.C., (2007) Int J Obes (Lond) 31 (3), 429-434
Ask a Question

Tell us what you think about this item!

Write A Review
    Please, wait...