Now Offering Over 102,157 Antibodies & 44,722 Antigens!

SEMA3D antibody - middle region (ARP55526_P050)

100 ul
$289.00
In Stock

Conjugation Options

ARP55526_P050-FITC Conjugated

ARP55526_P050-HRP Conjugated

ARP55526_P050-Biotin Conjugated

Gene Symbol:
SEMA3D
NCBI Gene Id:
223117
Official Gene Full Name:
Sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3D
Protein Name:
Semaphorin-3D
Swissprot Id:
O95025
Protein Accession #:
NP_689967
Nucleotide Accession #:
NM_152754
Alias Symbols:
MGC39708, Sema-Z2, coll-2
Replacement Item:
This antibody may replace item sc-10720 from Santa Cruz Biotechnology.
Description of Target:
SEMA3D induces the collapse and paralysis of neuronal growth cones. SEMA3D could potentially act as repulsive cues toward specific neuronal populations.
Protein Size (# AA):
777
Molecular Weight:
90kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express SEMA3D.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express SEMA3D.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human SEMA3D
Species Reactivity:
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data:
Anti-SEMA3D (ARP55526_P050)
Peptide Sequence:
Synthetic peptide located within the following region: LECIPKSQQATIKWYIQRSGDEHREELKPDERIIKTEYGLLIRSLQKKDS
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-SEMA3D (ARP55526_P050) antibody is Catalog # AAP55526
Datasheets/Manuals:
Printable datasheet for anti-SEMA3D (ARP55526_P050) antibody

Tell us what you think about this item!

Write A Review
    Please, wait...