Now Offering Over 102,157 Antibodies & 44,722 Antigens!

Scytovirin Recombinant Protein (Blood fluke) (OPCA05270)

$255.00
In Stock
Gene Symbol:
Scytovirin
Description of Target:
Has strong anti-HIV activity against T-tropic strains of HIV-1 and weaker activity against M-tropic strains of HIV-1. Inhibits HIV-1 fusion and infection of CD4 LTR beta-gal cells in vitro. Inhibits fusion of HIV infected CEM-SS cells with uninfected CEM-SS cells, and fusion of HIV-1 Env expressing HL2/3 cells with CD4 LTR beta-gal cells. Binds to HIV gp120, HIV gp160 and to a lesser extent HIV gp41. Binding to HIV gp120 is glycosylation dependent. Binds with high specificity to the tetrasaccharide Man-alpha-1,2-Man-alpha-1,6-Man-alpha-1,6-Man and also binds the higher-order oligosaccharides oligomannose 8 and oligomannose 9. Does not bind to monosaccharides, complex or hybrid N-linked oligosaccharides or chitin.
Swissprot Id:
P86041
Protein Name:
Scytovirin
Molecular Weight:
24 kDa
Product Format:
Liquid
Species Reactivity:
Blood fluke
Formulation:
Tris-base, 50% glycerol
Purity:
Greater than 90% as determined by SDS-PAGE.
Protein Sequence:
Full Length: GSGPTYCWNEANNPGGPNRCSNNKQCDGARTCSSSGFCQGTSRKPDPGPKGPTYCWDEAKNPGGPNRCSNSKQCDGARTCSSSGFCQGTAGHAAA
Storage Buffer:
Tris-base, 50% glycerol
Source:
E.coli
Additional Information:
Species Specificity Detail: Schistosoma mansoni (Blood fluke)
Tag:
N-terminal 6xHis-B2M-tagged
Reconstitution and Storage:
Store at -20/-80C for 12 months. Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Target Reference:
A potent novel anti-HIV protein from the cultured cyanobacterium Scytonema varium.
Bokesch H.R., O'Keefe B.R., McKee T.C., Pannell L.K., Patterson G.M.L., Gardella R.S., Sowder R.C. II, Turpin J., Watson K., Buckheit R.W. Jr., Boyd M.R.
Biochemistry 42:2578-2584(2003)
Datasheets/Manuals:
Printable datasheet for OPCA05270
Protocol:
Tips Information:

Tell us what you think about this item!

Write A Review
    Please, wait...