Now Offering Over 102,157 Antibodies & 44,722 Antigens!

SCN5A antibody - N-terminal region (ARP34934_P050)

100 ul

Regular Price: $289.00

Special Price: $215.00

In Stock

Conjugation Options

ARP34934_P050-FITC Conjugated

ARP34934_P050-HRP Conjugated

ARP34934_P050-Biotin Conjugated

Gene Symbol:
SCN5A
NCBI Gene Id:
6331
Official Gene Full Name:
Sodium channel, voltage-gated, type V, alpha subunit
Protein Name:
Sodium channel protein type 5 subunit alpha
Swissprot Id:
Q14524
Protein Accession #:
NP_000326
Nucleotide Accession #:
NM_000335
Alias Symbols:
CDCD2, CMD1E, CMPD2, HB1, HB2, HBBD, HH1, ICCD, IVF, LQT3, Nav1.5, PFHB1, SSS1, VF1
Replacement Item:
This antibody may replace item sc-22758 from Santa Cruz Biotechnology.
Description of Target:
SCN5A is an integral membrane protein and tetrodotoxin-resistant voltage-gated sodium channel subunit. The protein is found primarily in cardiac muscle and is responsible for the initial upstroke of the action potential in an electrocardiogram. The protein encoded by this gene is an integral membrane protein and tetrodotoxin-resistant voltage-gated sodium channel subunit. This protein is found primarily in cardiac muscle and is responsible for the initial upstroke of the action potential in an electrocardiogram. Defects in this gene are a cause of long QT syndrome type 3 (LQT3), an autosomal dominant cardiac disease. Alternative splicing results in several transcript variants encoding different isoforms.
Protein Size (# AA):
2015
Molecular Weight:
227kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB, IHC
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express SCN5A.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express SCN5A.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human SCN5A
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 77%
Complete computational species homology data:
Anti-SCN5A (ARP34934_P050)
Peptide Sequence:
Synthetic peptide located within the following region: SEADFADDENSTAGESESHHTSLLVPWPLRRTSAQGQPSPGTSAPGHALH
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
CALM1; CAV3; ALB; Nedd4; WWP2; UBC; SNTG2; NEDD4L; DLG2; INADL; DLG4; RGS3; SNTA1; DLG1; RGS2; SCN5A; SNTB2; SNTB1; DLG3; CBL;
Blocking Peptide:
For anti-SCN5A (ARP34934_P050) antibody is Catalog # AAP34934 (Previous Catalog # AAPP06157)
Datasheets/Manuals:
Printable datasheet for anti-SCN5A (ARP34934_P050) antibody
Subunit:
alpha
Target Reference:
Van (2008) Heart Rhythm 5 (5), 712-715
Publications:

Matsushita, N. et al. Nicorandil improves electrical remodelling, leading to the prevention of electrically induced ventricular tachyarrhythmia in a mouse model of desmin-related cardiomyopathy. Clin. Exp. Pharmacol. Physiol. 41, 89-97 (2014). WB, IHC, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 24117876

Tell us what you think about this item!

Write A Review
    Please, wait...