Now Offering Over 102,157 Antibodies & 44,722 Antigens!

SCARB1 Antibody - C-terminal region (OABB01985)

Scroll Horizontally to view all Images
Print Page
100 ug
$289.00
In Stock
Gene Symbol:
SCARB1
NCBI Gene Id:
20778
Official Gene Full Name:
Scavenger receptor class B member 1
Swissprot Id:
Q61009
Alias Symbols:
CD36, Cla1, SRBI, Srb1, Cla-1, Hdlq1, SR-B1, SR-BI, Cd36l1, Hlb398, mSR-BI, AI120173, D5Ertd460e
Replacement Item:
This antibody may replace item sc-32342 from Santa Cruz Biotechnology.
Description of Target:
Scavenger receptor class B member 1 (SRB1), also known as SR-BI, is a protein that in humans is encoded by the SCARB1 gene. SR-BI functions as a receptor for high-density lipoprotein. Scavenger receptor class B, type I (SR-BI) is an integral membrane protein found in numerous cell types/tissues, including the liver and adrenal. It is best known for its role in facilitating the uptake of cholesteryl esters from high-density lipoproteins in the liver. This process drives the movement of cholesterol from peripheral tissues towards the liver for excretion. This movement of cholesterol is known as reverse cholesterol transport and is a protective mechanism against the development of atherosclerosis, which is the principal cause of heart disease and stroke. SR-BI has also been identified in the livers of non-mammalian species (turtle, goldfish, shark, chicken, frog, and skate), suggesting it emerged early in vertebrate evolutionary history. The turtle also seems to upregulate SB-RI during egg development, indicating that cholesterol efflux may be at peak levels during developmental stages.
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Immunogen affinity purified.
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express SCARB1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express SCARB1.
Immunogen:
A synthetic peptide corresponding to a sequence at the C-terminus of mouse SCARB1 (478-509aa KKGSQDKEAIQAYSESLMSPAAKGTVLQEAKL), different from the related rat sequence by one amino acid.
Species Reactivity:
Mouse, Rat
Peptide Sequence:
Synthetic peptide located within the following region: KKGSQDKEAIQAYSESLMSPAAKGTVLQEAKL
Product Format:
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Reconstitution and Storage:
Add 0.2 ml of distilled water will yield a concentration of 500 ug/ml. +4C
Datasheets/Manuals:
Printable datasheet for anti-SCARB1 (OABB01985) antibody
Isotype:
IgG
Application Info:
Tested Species: In-house tested species with positive results.
Other applications have not been tested.
Optimal dilutions should be determined by end users.
Target Reference:
1. "Entrez Gene: SCARB1 Scavenger receptor class B, member 1".
2. Acton S, Rigotti A, Landschulz KT, Xu S, Hobbs HH, Krieger M (January 1996). "Identification of scavenger receptor SR-BI as a high density lipoprotein receptor".Science 271 (5248): 518–20.
3. Duggan AE, Marie RS, Callard IP (April 2002). "Expression of SR-BI (Scavenger Receptor Class B Type I) in turtle (Chrysemys picta) tissues and other nonmammalian vertebrates". J. Exp. Zool.292 (5): 430–4.
Protocol:
Tips Information:
 
X
Ask a Question

Tell us what you think about this item!

Write A Review
    Please, wait...